General Information of Drug Off-Target (DOT) (ID: OT7VW6RP)

DOT Name E3 ubiquitin-protein ligase TRIM31 (TRIM31)
Synonyms EC 2.3.2.27; Tripartite motif-containing protein 31
Gene Name TRIM31
Related Disease
Hepatitis B virus infection ( )
Ankylosing spondylitis ( )
Attention deficit hyperactivity disorder ( )
Autoimmune thyroid disease ( )
Barrett esophagus ( )
Breast carcinoma ( )
Esophageal adenocarcinoma ( )
Familial multiple trichoepithelioma ( )
Gastric cancer ( )
Glioma ( )
Hemochromatosis ( )
Hepatocellular carcinoma ( )
Irritant contact dermatitis ( )
Lung adenocarcinoma ( )
Major depressive disorder ( )
Mental disorder ( )
Myasthenia gravis ( )
Prostate carcinoma ( )
Rheumatoid arthritis ( )
Schizophrenia ( )
Stomach cancer ( )
Type-1 diabetes ( )
Type-1/2 diabetes ( )
Vitiligo ( )
Advanced cancer ( )
Colorectal carcinoma ( )
Pancreatic cancer ( )
Gallbladder cancer ( )
Gallbladder carcinoma ( )
Lung cancer ( )
Metastatic malignant neoplasm ( )
Systemic lupus erythematosus ( )
Tuberous sclerosis ( )
UniProt ID
TRI31_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
2YSJ; 2YSL
EC Number
2.3.2.27
Pfam ID
PF00643 ; PF15227
Sequence
MASGQFVNKLQEEVICPICLDILQKPVTIDCGHNFCLKCITQIGETSCGFFKCPLCKTSV
RKNAIRFNSLLRNLVEKIQALQASEVQSKRKEATCPRHQEMFHYFCEDDGKFLCFVCRES
KDHKSHNVSLIEEAAQNYQGQIQEQIQVLQQKEKETVQVKAQGVHRVDVFTDQVEHEKQR
ILTEFELLHQVLEEEKNFLLSRIYWLGHEGTEAGKHYVASTEPQLNDLKKLVDSLKTKQN
MPPRQLLEDIKVVLCRSEEFQFLNPTPVPLELEKKLSEAKSRHDSITGSLKKFKDQLQAD
RKKDENRFFKSMNKNDMKSWGLLQKNNHKMNKTSEPGSSSAGGRTTSGPPNHHSSAPSHS
LFRASSAGKVTFPVCLLASYDEISGQGASSQDTKTFDVALSEELHAALSEWLTAIRAWFC
EVPSS
Function
E3 ubiquitin-protein ligase that acts as a regulator of antiviral immune response and inflammation by mediating ubiquitination of substrates. Acts as a regulator of innate immune defense against viruses by mediating 'Lys-63'-linked ubiquitination of MAVS, promoting MAVS polymerization and formation of three-stranded helical filaments on mitochondria. Acts as a negative regulator of the NLRP3 inflammasome by catalyzing 'Lys-48'-linked ubiquitination of NLRP3, leading to its degradation. Regulator of Src-induced anchorage independent cell growth.
Tissue Specificity Up-regulated in gastric adenocarcinomas.
Reactome Pathway
Interferon gamma signaling (R-HSA-877300 )

Molecular Interaction Atlas (MIA) of This DOT

33 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Hepatitis B virus infection DISLQ2XY Definitive Biomarker [1]
Ankylosing spondylitis DISRC6IR Strong Genetic Variation [2]
Attention deficit hyperactivity disorder DISL8MX9 Strong Genetic Variation [3]
Autoimmune thyroid disease DISIHC6A Strong Genetic Variation [4]
Barrett esophagus DIS416Y7 Strong Altered Expression [5]
Breast carcinoma DIS2UE88 Strong Genetic Variation [6]
Esophageal adenocarcinoma DISODWFP Strong Altered Expression [5]
Familial multiple trichoepithelioma DISKZAUY Strong Altered Expression [5]
Gastric cancer DISXGOUK Strong Altered Expression [7]
Glioma DIS5RPEH Strong Biomarker [8]
Hemochromatosis DISAPY0H Strong Biomarker [9]
Hepatocellular carcinoma DIS0J828 Strong Biomarker [10]
Irritant contact dermatitis DIS62JY3 Strong Biomarker [11]
Lung adenocarcinoma DISD51WR Strong Genetic Variation [12]
Major depressive disorder DIS4CL3X Strong Genetic Variation [13]
Mental disorder DIS3J5R8 Strong Genetic Variation [3]
Myasthenia gravis DISELRCI Strong Genetic Variation [14]
Prostate carcinoma DISMJPLE Strong Genetic Variation [15]
Rheumatoid arthritis DISTSB4J Strong Genetic Variation [16]
Schizophrenia DISSRV2N Strong Genetic Variation [17]
Stomach cancer DISKIJSX Strong Altered Expression [7]
Type-1 diabetes DIS7HLUB Strong Genetic Variation [4]
Type-1/2 diabetes DISIUHAP Strong Genetic Variation [18]
Vitiligo DISR05SL Strong Genetic Variation [19]
Advanced cancer DISAT1Z9 moderate Altered Expression [20]
Colorectal carcinoma DIS5PYL0 moderate Biomarker [20]
Pancreatic cancer DISJC981 moderate Biomarker [21]
Gallbladder cancer DISXJUAF Limited Biomarker [22]
Gallbladder carcinoma DISD6ACL Limited Biomarker [22]
Lung cancer DISCM4YA Limited Genetic Variation [23]
Metastatic malignant neoplasm DIS86UK6 Limited Biomarker [24]
Systemic lupus erythematosus DISI1SZ7 Limited Genetic Variation [25]
Tuberous sclerosis DISEMUGZ Limited Biomarker [10]
------------------------------------------------------------------------------------
⏷ Show the Full List of 33 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
6 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Ciclosporin DMAZJFX Approved Ciclosporin increases the expression of E3 ubiquitin-protein ligase TRIM31 (TRIM31). [26]
Tretinoin DM49DUI Approved Tretinoin increases the expression of E3 ubiquitin-protein ligase TRIM31 (TRIM31). [27]
Acetaminophen DMUIE76 Approved Acetaminophen decreases the expression of E3 ubiquitin-protein ligase TRIM31 (TRIM31). [28]
Phenobarbital DMXZOCG Approved Phenobarbital increases the expression of E3 ubiquitin-protein ligase TRIM31 (TRIM31). [30]
Isotretinoin DM4QTBN Approved Isotretinoin increases the expression of E3 ubiquitin-protein ligase TRIM31 (TRIM31). [31]
Capecitabine DMTS85L Approved Capecitabine increases the expression of E3 ubiquitin-protein ligase TRIM31 (TRIM31). [32]
------------------------------------------------------------------------------------
⏷ Show the Full List of 6 Drug(s)
2 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Arsenic DMTL2Y1 Approved Arsenic affects the methylation of E3 ubiquitin-protein ligase TRIM31 (TRIM31). [29]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the methylation of E3 ubiquitin-protein ligase TRIM31 (TRIM31). [33]
------------------------------------------------------------------------------------

References

1 Type-I-IFN-Stimulated Gene TRIM5 Inhibits HBV Replication by Promoting HBx Degradation.Cell Rep. 2019 Dec 10;29(11):3551-3563.e3. doi: 10.1016/j.celrep.2019.11.041.
2 Interaction between ERAP1 and HLA-B27 in ankylosing spondylitis implicates peptide handling in the mechanism for HLA-B27 in disease susceptibility.Nat Genet. 2011 Jul 10;43(8):761-7. doi: 10.1038/ng.873.
3 The ATXN1 and TRIM31 genes are related to intelligence in an ADHD background: evidence from a large collaborative study totaling 4,963 subjects.Am J Med Genet B Neuropsychiatr Genet. 2011 Mar;156(2):145-57. doi: 10.1002/ajmg.b.31149. Epub 2010 Dec 16.
4 Genome wide identification of new genes and pathways in patients with both autoimmune thyroiditis and type 1 diabetes.J Autoimmun. 2015 Jun;60:32-9. doi: 10.1016/j.jaut.2015.03.006. Epub 2015 Apr 27.
5 RING finger proteins are involved in the progression of barrett esophagus to esophageal adenocarcinoma: a preliminary study.Gut Liver. 2014 Sep;8(5):487-94. doi: 10.5009/gnl13133. Epub 2014 Feb 24.
6 Association analysis identifies 65 new breast cancer risk loci.Nature. 2017 Nov 2;551(7678):92-94. doi: 10.1038/nature24284. Epub 2017 Oct 23.
7 The cellular level of TRIM31, an RBCC protein overexpressed in gastric cancer, is regulated by multiple mechanisms including the ubiquitin-proteasome system.Cell Biol Int. 2011 Jul;35(7):657-61. doi: 10.1042/CBI20100772.
8 TRIM31 promotes glioma proliferation and invasion through activating NF-B pathway.Onco Targets Ther. 2019 Mar 27;12:2289-2297. doi: 10.2147/OTT.S183625. eCollection 2019.
9 Localization of seven new genes around the HLA-A locus.Hum Mol Genet. 1993 Jan;2(1):55-60. doi: 10.1093/hmg/2.1.55.
10 TRIM31 is upregulated in hepatocellular carcinoma and promotes disease progression by inducing ubiquitination of TSC1-TSC2 complex.Oncogene. 2018 Jan 25;37(4):478-488. doi: 10.1038/onc.2017.349. Epub 2017 Oct 2.
11 Association of MHC region SNPs with irritant susceptibility in healthcare workers. J Immunotoxicol. 2016 Sep;13(5):738-44. doi: 10.3109/1547691X.2016.1173135. Epub 2016 Jun 3.
12 A genome-wide association study of lung cancer identifies a region of chromosome 5p15 associated with risk for adenocarcinoma.Am J Hum Genet. 2009 Nov;85(5):679-91. doi: 10.1016/j.ajhg.2009.09.012. Epub 2009 Oct 15.
13 Genome-wide association study of depression phenotypes in UK Biobank identifies variants in excitatory synaptic pathways.Nat Commun. 2018 Apr 16;9(1):1470. doi: 10.1038/s41467-018-03819-3.
14 Risk for myasthenia gravis maps to a (151) ProAla change in TNIP1 and to human leukocyte antigen-B*08.Ann Neurol. 2012 Dec;72(6):927-35. doi: 10.1002/ana.23691. Epub 2012 Oct 10.
15 Association analyses of more than 140,000 men identify 63 new prostate cancer susceptibility loci.Nat Genet. 2018 Jul;50(7):928-936. doi: 10.1038/s41588-018-0142-8. Epub 2018 Jun 11.
16 REL, encoding a member of the NF-kappaB family of transcription factors, is a newly defined risk locus for rheumatoid arthritis.Nat Genet. 2009 Jul;41(7):820-3. doi: 10.1038/ng.395. Epub 2009 Jun 7.
17 Meta-analysis of GWAS of over 16,000 individuals with autism spectrum disorder highlights a novel locus at 10q24.32 and a significant overlap with schizophrenia.Mol Autism. 2017 May 22;8:21. doi: 10.1186/s13229-017-0137-9. eCollection 2017.
18 Mapping eGFR loci to the renal transcriptome and phenome in the VA Million Veteran Program.Nat Commun. 2019 Aug 26;10(1):3842. doi: 10.1038/s41467-019-11704-w.
19 Genome-wide association study for vitiligo identifies susceptibility loci at 6q27 and the MHC.Nat Genet. 2010 Jul;42(7):614-8. doi: 10.1038/ng.603. Epub 2010 Jun 6.
20 TRIM31 regulates chronic inflammation via NF-B signal pathway to promote invasion and metastasis in colorectal cancer.Am J Transl Res. 2018 Apr 15;10(4):1247-1259. eCollection 2018.
21 Oncogenic TRIM31 confers gemcitabine resistance in pancreatic cancer via activating the NF-B signaling pathway.Theranostics. 2018 May 11;8(12):3224-3236. doi: 10.7150/thno.23259. eCollection 2018.
22 Knockdown of TRIM31 suppresses proliferation and invasion of gallbladder cancer cells by down-regulating MMP2/9 through the PI3K/Akt signaling pathway.Biomed Pharmacother. 2018 Jul;103:1272-1278. doi: 10.1016/j.biopha.2018.04.120. Epub 2018 May 7.
23 Influence of common genetic variation on lung cancer risk: meta-analysis of 14 900 cases and 29 485 controls.Hum Mol Genet. 2012 Nov 15;21(22):4980-95. doi: 10.1093/hmg/dds334. Epub 2012 Aug 16.
24 Tripartite motif 31 promotes resistance to anoikis of hepatocarcinoma cells through regulation of p53-AMPK axis.Exp Cell Res. 2018 Jul 1;368(1):59-66. doi: 10.1016/j.yexcr.2018.04.013. Epub 2018 Apr 14.
25 GWAS identifies novel SLE susceptibility genes and explains the association of the HLA region.Genes Immun. 2014 Sep;15(6):347-54. doi: 10.1038/gene.2014.23. Epub 2014 May 29.
26 Integrative "-Omics" analysis in primary human hepatocytes unravels persistent mechanisms of cyclosporine A-induced cholestasis. Chem Res Toxicol. 2016 Dec 19;29(12):2164-2174.
27 Agonist and antagonist of retinoic acid receptors cause similar changes in gene expression and induce senescence-like growth arrest in MCF-7 breast carcinoma cells. Cancer Res. 2006 Sep 1;66(17):8749-61.
28 Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
29 Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
30 Dose- and time-dependent effects of phenobarbital on gene expression profiling in human hepatoma HepaRG cells. Toxicol Appl Pharmacol. 2009 Feb 1;234(3):345-60.
31 Gene microarray analysis of human renal cell carcinoma: the effects of HDAC inhibition and retinoid treatment. Cancer Biol Ther. 2008 Oct;7(10):1607-18.
32 Gene expression responses reflecting 5-FU-induced toxicity: Comparison between patient colon tissue and 3D human colon organoids. Toxicol Lett. 2022 Dec 1;371:17-24. doi: 10.1016/j.toxlet.2022.09.013. Epub 2022 Sep 29.
33 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.