Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT9N2WOF)

• DOT Name: Receptor-type tyrosine-protein phosphatase gamma (PTPRG)
• Synonyms: Protein-tyrosine phosphatase gamma; R-PTP-gamma; EC 3.1.3.48
• Gene Name: PTPRG
• Related Disease:
  B-cell neoplasm
  Cognitive impairment
  Adenoma
  Advanced cancer
  Alzheimer disease
  Attention deficit hyperactivity disorder
  Autism spectrum disorder
  Bacteremia
  Breast cancer
  Breast carcinoma
  Childhood acute lymphoblastic leukemia
  Clear cell renal carcinoma
  Colon cancer
  Colon carcinoma
  Colorectal carcinoma
  Fleck corneal dystrophy
  Fuchs' endothelial dystrophy
  Gastric cancer
  Gastric neoplasm
  Hereditary breast carcinoma
  Hereditary diffuse gastric adenocarcinoma
  Hereditary nonpolyposis colon cancer
  Lung carcinoma
  Lung large cell carcinoma
  Lynch syndrome
  Malignant soft tissue neoplasm
  Mental disorder
  Neoplasm
  Pancreatic cancer
  Renal cell carcinoma
  Sarcoma
  Schizophrenia
  Stomach cancer
  Bipolar disorder
  Corneal dystrophy
  Lung adenocarcinoma
  Nasopharyngeal carcinoma
  Stroke
  Acute lymphocytic leukaemia
  Acute myelogenous leukaemia
  Fish eye disease
  Primary cutaneous T-cell lymphoma
• UniProt ID: PTPRG_HUMAN
• PDB ID: 2H4V; 2HY3; 2NLK; 2PBN; 3JXH; 3QCB; 3QCC; 3QCD; 3QCE; 3QCF; 3QCG; 3QCH; 3QCI; 3QCJ; 3QCK; 3QCL; 3QCM; 3QCN; 5E5R
• EC Number: 3.1.3.48
• Pfam ID: PF00194 ; PF00041 ; PF00102
• Sequence:
  MRRLLEPCWWILFLKITSSVLHYVVCFPALTEGYVGALHENRHGSAVQIRRRKASGDPYW
  AYSGAYGPEHWVTSSVSCGGRHQSPIDILDQYARVGEEYQELQLDGFDNESSNKTWMKNT
  GKTVAILLKDDYFVSGAGLPGRFKAEKVEFHWGHSNGSAGSEHSINGRRFPVEMQIFFYN
  PDDFDSFQTAISENRIIGAMAIFFQVSPRDNSALDPIIHGLKGVVHHEKETFLDPFVLRD
  LLPASLGSYYRYTGSLTTPPCSEIVEWIVFRRPVPISYHQLEAFYSIFTTEQQDHVKSVE
  YLRNNFRPQQRLHDRVVSKSAVRDSWNHDMTDFLENPLGTEASKVCSSPPIHMKVQPLNQ
  TALQVSWSQPETIYHPPIMNYMISYSWTKNEDEKEKTFTKDSDKDLKATISHVSPDSLYL
  FRVQAVCRNDMRSDFSQTMLFQANTTRIFQGTRIVKTGVPTASPASSADMAPISSGSSTW
  TSSGIPFSFVSMATGMGPSSSGSQATVASVVTSTLLAGLGFGGGGISSFPSTVWPTRLPT
  AASASKQAARPVLATTEALASPGPDGDSSPTKDGEGTEEGEKDEKSESEDGEREHEEDGE
  KDSEKKEKSGVTHAAEERNQTEPSPTPSSPNRTAEGGHQTIPGHEQDHTAVPTDQTGGRR
  DAGPGLDPDMVTSTQVPPTATEEQYAGSDPKRPEMPSKKPMSRGDRFSEDSRFITVNPAE
  KNTSGMISRPAPGRMEWIIPLIVVSALTFVCLILLIAVLVYWRGCNKIKSKGFPRRFREV
  PSSGERGEKGSRKCFQTAHFYVEDSSSPRVVPNESIPIIPIPDDMEAIPVKQFVKHIGEL
  YSNNQHGFSEDFEEVQRCTADMNITAEHSNHPENKHKNRYINILAYDHSRVKLRPLPGKD
  SKHSDYINANYVDGYNKAKAYIATQGPLKSTFEDFWRMIWEQNTGIIVMITNLVEKGRRK
  CDQYWPTENSEEYGNIIVTLKSTKIHACYTVRRFSIRNTKVKKGQKGNPKGRQNERVVIQ
  YHYTQWPDMGVPEYALPVLTFVRRSSAARMPETGPVLVHCSAGVGRTGTYIVIDSMLQQI
  KDKSTVNVLGFLKHIRTQRNYLVQTEEQYIFIHDALLEAILGKETEVSSNQLHSYVNSIL
  IPGVGGKTRLEKQFKLVTQCNAKYVECFSAQKECNKEKNRNSSVVPSERARVGLAPLPGM
  KGTDYINASYIMGYYRSNEFIITQHPLPHTTKDFWRMIWDHNAQIIVMLPDNQSLAEDEF
  VYWPSREESMNCEAFTVTLISKDRLCLSNEEQIIIHDFILEATQDDYVLEVRHFQCPKWP
  NPDAPISSTFELINVIKEEALTRDGPTIVHDEYGAVSAGMLCALTTLSQQLENENAVDVF
  QVAKMINLMRPGVFTDIEQYQFIYKAMLSLVSTKENGNGPMTVDKNGAVLIADESDPAES
  MESLV
• Function: Possesses tyrosine phosphatase activity.
• Tissue Specificity: Found in a variety of tissues.

Molecular Interaction Atlas (MIA) of This DOT

42 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
B-cell neoplasm	DISVY326	Definitive	Altered Expression	[1]
Cognitive impairment	DISH2ERD	Definitive	Biomarker	[2]
Adenoma	DIS78ZEV	Strong	Posttranslational Modification	[3]
Advanced cancer	DISAT1Z9	Strong	Biomarker	[4]
Alzheimer disease	DISF8S70	Strong	Genetic Variation	[5]
Attention deficit hyperactivity disorder	DISL8MX9	Strong	Genetic Variation	[6]
Autism spectrum disorder	DISXK8NV	Strong	Biomarker	[7]
Bacteremia	DIS6N9RZ	Strong	Genetic Variation	[8]
Breast cancer	DIS7DPX1	Strong	Genetic Variation	[9]
Breast carcinoma	DIS2UE88	Strong	Genetic Variation	[9]
Childhood acute lymphoblastic leukemia	DISJ5D6U	Strong	Posttranslational Modification	[10]
Clear cell renal carcinoma	DISBXRFJ	Strong	Genetic Variation	[11]
Colon cancer	DISVC52G	Strong	Biomarker	[3]
Colon carcinoma	DISJYKUO	Strong	Biomarker	[3]
Colorectal carcinoma	DIS5PYL0	Strong	Posttranslational Modification	[3]
Fleck corneal dystrophy	DISERQJ1	Strong	Biomarker	[12]
Fuchs' endothelial dystrophy	DISL7TXC	Strong	Genetic Variation	[12]
Gastric cancer	DISXGOUK	Strong	Biomarker	[13]
Gastric neoplasm	DISOKN4Y	Strong	Posttranslational Modification	[13]
Hereditary breast carcinoma	DISAEZT5	Strong	Genetic Variation	[9]
Hereditary diffuse gastric adenocarcinoma	DISUIBYS	Strong	Biomarker	[13]
Hereditary nonpolyposis colon cancer	DISPA49R	Strong	Posttranslational Modification	[3]
Lung carcinoma	DISTR26C	Strong	Biomarker	[14]
Lung large cell carcinoma	DISUG64F	Strong	Altered Expression	[15]
Lynch syndrome	DIS3IW5F	Strong	Posttranslational Modification	[3]
Malignant soft tissue neoplasm	DISTC6NO	Strong	Genetic Variation	[16]
Mental disorder	DIS3J5R8	Strong	Biomarker	[7]
Neoplasm	DISZKGEW	Strong	Biomarker	[17]
Pancreatic cancer	DISJC981	Strong	Altered Expression	[18]
Renal cell carcinoma	DISQZ2X8	Strong	Genetic Variation	[11]
Sarcoma	DISZDG3U	Strong	Genetic Variation	[16]
Schizophrenia	DISSRV2N	Strong	Altered Expression	[7]
Stomach cancer	DISKIJSX	Strong	Posttranslational Modification	[13]
Bipolar disorder	DISAM7J2	moderate	Genetic Variation	[6]
Corneal dystrophy	DISRDPA6	moderate	Genetic Variation	[19]
Lung adenocarcinoma	DISD51WR	moderate	Biomarker	[20]
Nasopharyngeal carcinoma	DISAOTQ0	moderate	Altered Expression	[21]
Stroke	DISX6UHX	moderate	Genetic Variation	[22]
Acute lymphocytic leukaemia	DISPX75S	Disputed	Posttranslational Modification	[23]
Acute myelogenous leukaemia	DISCSPTN	Limited	Genetic Variation	[24]
Fish eye disease	DISYTZNQ	Limited	Genetic Variation	[25]
Primary cutaneous T-cell lymphoma	DIS35WVW	Limited	Posttranslational Modification	[26]

This DOT Affected the Drug Response of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Methotrexate	DM2TEOL	Approved	Receptor-type tyrosine-protein phosphatase gamma (PTPRG) affects the response to substance of Methotrexate.	[49]

19 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Receptor-type tyrosine-protein phosphatase gamma (PTPRG).	[27]
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Receptor-type tyrosine-protein phosphatase gamma (PTPRG).	[28]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Receptor-type tyrosine-protein phosphatase gamma (PTPRG).	[29]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Receptor-type tyrosine-protein phosphatase gamma (PTPRG).	[30]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of Receptor-type tyrosine-protein phosphatase gamma (PTPRG).	[31]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Receptor-type tyrosine-protein phosphatase gamma (PTPRG).	[32]
Quercetin	DM3NC4M	Approved	Quercetin decreases the expression of Receptor-type tyrosine-protein phosphatase gamma (PTPRG).	[34]
Zoledronate	DMIXC7G	Approved	Zoledronate increases the expression of Receptor-type tyrosine-protein phosphatase gamma (PTPRG).	[36]
Dexamethasone	DMMWZET	Approved	Dexamethasone increases the expression of Receptor-type tyrosine-protein phosphatase gamma (PTPRG).	[37]
Niclosamide	DMJAGXQ	Approved	Niclosamide decreases the expression of Receptor-type tyrosine-protein phosphatase gamma (PTPRG).	[38]
Isotretinoin	DM4QTBN	Approved	Isotretinoin increases the expression of Receptor-type tyrosine-protein phosphatase gamma (PTPRG).	[39]
Irinotecan	DMP6SC2	Approved	Irinotecan decreases the expression of Receptor-type tyrosine-protein phosphatase gamma (PTPRG).	[40]
Melphalan	DMOLNHF	Approved	Melphalan decreases the expression of Receptor-type tyrosine-protein phosphatase gamma (PTPRG).	[41]
Resveratrol	DM3RWXL	Phase 3	Resveratrol decreases the expression of Receptor-type tyrosine-protein phosphatase gamma (PTPRG).	[42]
Afimoxifene	DMFORDT	Phase 2	Afimoxifene increases the expression of Receptor-type tyrosine-protein phosphatase gamma (PTPRG).	[43]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of Receptor-type tyrosine-protein phosphatase gamma (PTPRG).	[44]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 increases the expression of Receptor-type tyrosine-protein phosphatase gamma (PTPRG).	[45]
Leflunomide	DMR8ONJ	Phase 1 Trial	Leflunomide increases the expression of Receptor-type tyrosine-protein phosphatase gamma (PTPRG).	[46]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of Receptor-type tyrosine-protein phosphatase gamma (PTPRG).	[47]

3 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Arsenic	DMTL2Y1	Approved	Arsenic affects the methylation of Receptor-type tyrosine-protein phosphatase gamma (PTPRG).	[33]
Decitabine	DMQL8XJ	Approved	Decitabine affects the methylation of Receptor-type tyrosine-protein phosphatase gamma (PTPRG).	[13]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the methylation of Receptor-type tyrosine-protein phosphatase gamma (PTPRG).	[48]

References

• [1] Epigenetic deregulation in pediatric acute lymphoblastic leukemia.Epigenetics. 2014 Mar;9(3):459-67. doi: 10.4161/epi.27585. Epub 2014 Jan 6.
• [2] Phenotypically distinct subtypes of psychosis accompany novel or rare variants in four different signaling genes.EBioMedicine. 2016 Apr;6:206-214. doi: 10.1016/j.ebiom.2016.03.008. Epub 2016 Mar 8.
• [3] Tumour-specific methylation of PTPRG intron 1 locus in sporadic and Lynch syndrome colorectal cancer.Eur J Hum Genet. 2011 Mar;19(3):307-12. doi: 10.1038/ejhg.2010.187. Epub 2010 Dec 8.
• [4] Targeting PTPRZ inhibits stem cell-like properties and tumorigenicity in glioblastoma cells.Sci Rep. 2017 Jul 17;7(1):5609. doi: 10.1038/s41598-017-05931-8.
• [5] Family-based association analyses of imputed genotypes reveal genome-wide significant association of Alzheimer's disease with OSBPL6, PTPRG, and PDCL3.Mol Psychiatry. 2016 Nov;21(11):1608-1612. doi: 10.1038/mp.2015.218. Epub 2016 Feb 2.
• [6] Genetic Overlap Between Attention-Deficit/Hyperactivity Disorder and Bipolar Disorder: Evidence From Genome-wide Association Study Meta-analysis.Biol Psychiatry. 2017 Nov 1;82(9):634-641. doi: 10.1016/j.biopsych.2016.08.040. Epub 2016 Oct 18.
• [7] Loss-of-function of PTPR and , observed in sporadic schizophrenia, causes brain region-specific deregulation of monoamine levels and altered behavior in mice.Psychopharmacology (Berl). 2017 Feb;234(4):575-587. doi: 10.1007/s00213-016-4490-8. Epub 2016 Dec 26.
• [8] Polymorphism in a lincRNA Associates with a Doubled Risk of Pneumococcal Bacteremia in Kenyan Children.Am J Hum Genet. 2016 Jun 2;98(6):1092-1100. doi: 10.1016/j.ajhg.2016.03.025. Epub 2016 May 26.
• [9] The FHIT and PTPRG genes are deleted in benign proliferative breast disease associated with familial breast cancer and cytogenetic rearrangements of chromosome band 3p14.Cancer Res. 1996 Nov 1;56(21):4871-5.
• [10] PTPRG inhibition by DNA methylation and cooperation with RAS gene activation in childhood acute lymphoblastic leukemia.Int J Cancer. 2014 Sep 1;135(5):1101-9. doi: 10.1002/ijc.28759. Epub 2014 Feb 19.
• [11] Structure of the human receptor tyrosine phosphatase gamma gene (PTPRG) and relation to the familial RCC t(3;8) chromosome translocation.Genomics. 1996 Mar 1;32(2):225-35. doi: 10.1006/geno.1996.0109.
• [12] Association of common variants in TCF4 and PTPRG with Fuchs' corneal dystrophy: a systematic review and meta-analysis.PLoS One. 2014 Oct 9;9(10):e109142. doi: 10.1371/journal.pone.0109142. eCollection 2014.
• [13] Metastatic suppressor genes inactivated by aberrant methylation in gastric cancer. World J Gastroenterol. 2007 Nov 21;13(43):5692-8. doi: 10.3748/wjg.v13.i43.5692.
• [14] Receptor protein-tyrosine phosphatase gamma is a candidate tumor suppressor gene at human chromosome region 3p21.Proc Natl Acad Sci U S A. 1991 Jun 1;88(11):5036-40. doi: 10.1073/pnas.88.11.5036.
• [15] Germline polymorphisms and survival of lung adenocarcinoma patients: a genome-wide study in two European patient series.Int J Cancer. 2015 Mar 1;136(5):E262-71. doi: 10.1002/ijc.29195. Epub 2014 Sep 19.
• [16] A homozygous deletion within the carbonic anhydrase-like domain of the Ptprg gene in murine L-cells.Cancer Res. 1993 Apr 1;53(7):1498-502.
• [17] Interdependence between EGFR and Phosphatases Spatially Established by Vesicular Dynamics Generates a Growth Factor Sensing and Responding Network.Cell Syst. 2018 Sep 26;7(3):295-309.e11. doi: 10.1016/j.cels.2018.06.006. Epub 2018 Aug 22.
• [18] Receptor-type protein tyrosine phosphatase gamma (PTPgamma), a new identifier for myeloid dendritic cells and specialized macrophages.Blood. 2006 Dec 15;108(13):4223-31. doi: 10.1182/blood-2006-05-024257. Epub 2006 Aug 8.
• [19] Association of transcription factor 4 (TCF4) and protein tyrosine phosphatase, receptor type G (PTPRG) with corneal dystrophies in southern Chinese.Ophthalmic Genet. 2014 Sep;35(3):138-41. doi: 10.3109/13816810.2013.804098. Epub 2013 Jun 12.
• [20] Circular RNA cMras inhibits lung adenocarcinoma progression via modulating miR-567/PTPRG regulatory pathway.Cell Prolif. 2019 May;52(3):e12610. doi: 10.1111/cpr.12610. Epub 2019 Apr 22.
• [21] PTPRG suppresses tumor growth and invasion via inhibition of Akt signaling in nasopharyngeal carcinoma.Oncotarget. 2015 May 30;6(15):13434-47. doi: 10.18632/oncotarget.3876.
• [22] Meta-Analysis of Genome-Wide Association Studies Identifies Genetic Risk Factors for Stroke in African Americans.Stroke. 2015 Aug;46(8):2063-8. doi: 10.1161/STROKEAHA.115.009044. Epub 2015 Jun 18.
• [23] DNA methylation of membrane-bound tyrosine phosphatase genes in acute lymphoblastic leukaemia.Leukemia. 2014 Apr;28(4):787-93. doi: 10.1038/leu.2013.270. Epub 2013 Sep 18.
• [24] Genome-wide haplotype association study identify the FGFR2 gene as a risk gene for acute myeloid leukemia.Oncotarget. 2017 Jan 31;8(5):7891-7899. doi: 10.18632/oncotarget.13631.
• [25] Association of TCF4 and CLU polymorphisms with Fuchs' endothelial dystrophy and implication of CLU and TGFBI proteins in the disease process.Eur J Hum Genet. 2012 Jun;20(6):632-8. doi: 10.1038/ejhg.2011.248. Epub 2012 Jan 11.
• [26] Epigenetic profiling of cutaneous T-cell lymphoma: promoter hypermethylation of multiple tumor suppressor genes including BCL7a, PTPRG, and p73.J Clin Oncol. 2005 Jun 10;23(17):3886-96. doi: 10.1200/JCO.2005.11.353. Epub 2005 May 16.
• [27] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [28] Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
• [29] Development of a neural teratogenicity test based on human embryonic stem cells: response to retinoic acid exposure. Toxicol Sci. 2011 Dec;124(2):370-7.
• [30] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [31] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [32] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [33] Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
• [34] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [35] Metastatic suppressor genes inactivated by aberrant methylation in gastric cancer. World J Gastroenterol. 2007 Nov 21;13(43):5692-8. doi: 10.3748/wjg.v13.i43.5692.
• [36] Interleukin-19 as a translational indicator of renal injury. Arch Toxicol. 2015 Jan;89(1):101-6.
• [37] Identification of mechanisms of action of bisphenol a-induced human preadipocyte differentiation by transcriptional profiling. Obesity (Silver Spring). 2014 Nov;22(11):2333-43.
• [38] Mitochondrial Uncoupling Induces Epigenome Remodeling and Promotes Differentiation in Neuroblastoma. Cancer Res. 2023 Jan 18;83(2):181-194. doi: 10.1158/0008-5472.CAN-22-1029.
• [39] Temporal changes in gene expression in the skin of patients treated with isotretinoin provide insight into its mechanism of action. Dermatoendocrinol. 2009 May;1(3):177-87.
• [40] Clinical determinants of response to irinotecan-based therapy derived from cell line models. Clin Cancer Res. 2008 Oct 15;14(20):6647-55.
• [41] Bone marrow osteoblast damage by chemotherapeutic agents. PLoS One. 2012;7(2):e30758. doi: 10.1371/journal.pone.0030758. Epub 2012 Feb 17.
• [42] Strategies for comparing gene expression profiles from different microarray platforms: application to a case-control experiment. Anal Biochem. 2006 Jun 1;353(1):43-56. doi: 10.1016/j.ab.2006.03.023. Epub 2006 Apr 3.
• [43] Gene expression preferentially regulated by tamoxifen in breast cancer cells and correlations with clinical outcome. Cancer Res. 2006 Jul 15;66(14):7334-40.
• [44] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [45] Inhibition of BRD4 attenuates tumor cell self-renewal and suppresses stem cell signaling in MYC driven medulloblastoma. Oncotarget. 2014 May 15;5(9):2355-71.
• [46] Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
• [47] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [48] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
• [49] Gene expression profiling of 30 cancer cell lines predicts resistance towards 11 anticancer drugs at clinically achieved concentrations. Int J Cancer. 2006 Apr 1;118(7):1699-712. doi: 10.1002/ijc.21570.