Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTAHB98A)

• DOT Name: Cytochrome b (CYTB)
• Synonyms: Complex III subunit 3; Complex III subunit III; Cytochrome b-c1 complex subunit 3; Ubiquinol-cytochrome-c reductase complex cytochrome b subunit
• Gene Name: CYTB
• Related Disease:
  Multiple sclerosis
  Pediculus capitis infestation
  Advanced cancer
  Alzheimer disease
  Arteriosclerosis
  Atherosclerosis
  Bladder cancer
  Carcinoma of esophagus
  Cardiovascular disease
  Chagas disease
  Cutaneous leishmaniasis
  Epilepsy
  Epithelial ovarian cancer
  Esophageal cancer
  Gastric cancer
  Hepatocellular carcinoma
  Lactic acidosis
  Leber hereditary optic neuropathy
  leukaemia
  Leukemia
  Melanoma
  MELAS syndrome
  Mitochondrial disease
  Mitochondrial encephalomyopathy
  Mitochondrial myopathy
  Myopathy
  Neoplasm
  Non-insulin dependent diabetes
  Parkinson disease
  Parkinsonian disorder
  Pneumonia
  Stomach cancer
  Thyrotoxicosis
  Triple negative breast cancer
  Type-1/2 diabetes
  Ulcerative colitis
  Urinary bladder cancer
  Urinary bladder neoplasm
  Granulomatous disease, chronic, X-linked
  Head-neck squamous cell carcinoma
  Obesity
  Visceral leishmaniasis
  Pneumocystis pneumonia
  Coronary heart disease
  Intellectual disability
  Leigh syndrome
  Mitochondrial myopathy with reversible cytochrome C oxidase deficiency
  Type-1 diabetes
• UniProt ID: CYB_HUMAN
• PDB ID: 5XTE; 5XTH; 5XTI
• Pfam ID: PF00032 ; PF00033
• Sequence:
  MTPMRKTNPLMKLINHSFIDLPTPSNISAWWNFGSLLGACLILQITTGLFLAMHYSPDAS
  TAFSSIAHITRDVNYGWIIRYLHANGASMFFICLFLHIGRGLYYGSFLYSETWNIGIILL
  LATMATAFMGYVLPWGQMSFWGATVITNLLSAIPYIGTDLVQWIWGGYSVDSPTLTRFFT
  FHFILPFIIAALATLHLLFLHETGSNNPLGITSHSDKITFHPYYTIKDALGLLLFLLSLM
  TLTLFSPDLLGDPDNYTLANPLNTPPHIKPEWYFLFAYTILRSVPNKLGGVLALLLSILI
  LAMIPILHMSKQQSMMFRPLSQSLYWLLAADLLILTWIGGQPVSYPFTIIGQVASVLYFT
  TILILMPTISLIENKMLKWA
• Function: Component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex) that is part of the mitochondrial respiratory chain. The b-c1 complex mediates electron transfer from ubiquinol to cytochrome c. Contributes to the generation of a proton gradient across the mitochondrial membrane that is then used for ATP synthesis.
• KEGG Pathway:
  Oxidative phosphorylation (hsa00190)
  Metabolic pathways (hsa01100)
  Cardiac muscle contraction (hsa04260)
  Thermogenesis (hsa04714)
  Non-alcoholic fatty liver disease (hsa04932)
  Alzheimer disease (hsa05010)
  Parkinson disease (hsa05012)
  Amyotrophic lateral sclerosis (hsa05014)
  Huntington disease (hsa05016)
  Prion disease (hsa05020)
  Pathways of neurodegeneration - multiple diseases (hsa05022)
  Chemical carcinogenesis - reactive oxygen species (hsa05208)
  Diabetic cardiomyopathy (hsa05415)
• Reactome Pathway: Respiratory electron transport (R-HSA-611105)
• BioCyc Pathway: MetaCyc:HS00029-MONOMER

Molecular Interaction Atlas (MIA) of This DOT

48 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Multiple sclerosis	DISB2WZI	Definitive	Biomarker	[1]
Pediculus capitis infestation	DISLZYDI	Definitive	Genetic Variation	[2]
Advanced cancer	DISAT1Z9	Strong	Biomarker	[3]
Alzheimer disease	DISF8S70	Strong	Altered Expression	[4]
Arteriosclerosis	DISK5QGC	Strong	Genetic Variation	[5]
Atherosclerosis	DISMN9J3	Strong	Genetic Variation	[5]
Bladder cancer	DISUHNM0	Strong	Genetic Variation	[6]
Carcinoma of esophagus	DISS6G4D	Strong	Genetic Variation	[7]
Cardiovascular disease	DIS2IQDX	Strong	Genetic Variation	[8]
Chagas disease	DIS8KNVF	Strong	Genetic Variation	[9]
Cutaneous leishmaniasis	DISRK7TS	Strong	Genetic Variation	[10]
Epilepsy	DISBB28L	Strong	Genetic Variation	[11]
Epithelial ovarian cancer	DIS56MH2	Strong	Altered Expression	[12]
Esophageal cancer	DISGB2VN	Strong	Genetic Variation	[7]
Gastric cancer	DISXGOUK	Strong	Biomarker	[13]
Hepatocellular carcinoma	DIS0J828	Strong	Altered Expression	[14]
Lactic acidosis	DISZI1ZK	Strong	Genetic Variation	[15]
Leber hereditary optic neuropathy	DIS7Y2EE	Strong	Genetic Variation	[16]
leukaemia	DISS7D1V	Strong	Genetic Variation	[17]
Leukemia	DISNAKFL	Strong	Genetic Variation	[17]
Melanoma	DIS1RRCY	Strong	Biomarker	[18]
MELAS syndrome	DIS81Z3S	Strong	Genetic Variation	[19]
Mitochondrial disease	DISKAHA3	Strong	Genetic Variation	[20]
Mitochondrial encephalomyopathy	DISA6PTN	Strong	Genetic Variation	[21]
Mitochondrial myopathy	DIS9SA7V	Strong	Genetic Variation	[22]
Myopathy	DISOWG27	Strong	Genetic Variation	[23]
Neoplasm	DISZKGEW	Strong	Altered Expression	[24]
Non-insulin dependent diabetes	DISK1O5Z	Strong	Biomarker	[25]
Parkinson disease	DISQVHKL	Strong	Genetic Variation	[26]
Parkinsonian disorder	DISHGY45	Strong	Genetic Variation	[27]
Pneumonia	DIS8EF3M	Strong	Biomarker	[28]
Stomach cancer	DISKIJSX	Strong	Biomarker	[13]
Thyrotoxicosis	DISWH7BV	Strong	Biomarker	[29]
Triple negative breast cancer	DISAMG6N	Strong	Altered Expression	[30]
Type-1/2 diabetes	DISIUHAP	Strong	Biomarker	[31]
Ulcerative colitis	DIS8K27O	Strong	Biomarker	[32]
Urinary bladder cancer	DISDV4T7	Strong	Genetic Variation	[6]
Urinary bladder neoplasm	DIS7HACE	Strong	Genetic Variation	[6]
Granulomatous disease, chronic, X-linked	DISNTTS3	moderate	Genetic Variation	[33]
Head-neck squamous cell carcinoma	DISF7P24	moderate	Altered Expression	[24]
Obesity	DIS47Y1K	moderate	Genetic Variation	[34]
Visceral leishmaniasis	DISTKEYK	moderate	Genetic Variation	[35]
Pneumocystis pneumonia	DISFSOM3	Disputed	Biomarker	[28]
Coronary heart disease	DIS5OIP1	Limited	Biomarker	[36]
Intellectual disability	DISMBNXP	Limited	Genetic Variation	[37]
Leigh syndrome	DISWQU45	Limited	CausalMutation	[21]
Mitochondrial myopathy with reversible cytochrome C oxidase deficiency	DISW3XTC	Limited	CausalMutation	[38]
Type-1 diabetes	DIS7HLUB	Limited	Biomarker	[31]

14 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Cytochrome b (CYTB).	[39]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Cytochrome b (CYTB).	[40]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Cytochrome b (CYTB).	[41]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide decreases the expression of Cytochrome b (CYTB).	[42]
Zidovudine	DM4KI7O	Approved	Zidovudine affects the expression of Cytochrome b (CYTB).	[43]
Urethane	DM7NSI0	Phase 4	Urethane increases the expression of Cytochrome b (CYTB).	[44]
Fialuridine	DMCIGRB	Phase 2	Fialuridine decreases the expression of Cytochrome b (CYTB).	[45]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of Cytochrome b (CYTB).	[46]
THAPSIGARGIN	DMDMQIE	Preclinical	THAPSIGARGIN decreases the expression of Cytochrome b (CYTB).	[47]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Cytochrome b (CYTB).	[48]
methyl p-hydroxybenzoate	DMO58UW	Investigative	methyl p-hydroxybenzoate decreases the expression of Cytochrome b (CYTB).	[49]
D-glucose	DMMG2TO	Investigative	D-glucose decreases the expression of Cytochrome b (CYTB).	[50]
2-AMINO-1-METHYL-6-PHENYLIMIDAZO[4,5-B]PYRIDINE	DMNQL17	Investigative	2-AMINO-1-METHYL-6-PHENYLIMIDAZO[4,5-B]PYRIDINE decreases the expression of Cytochrome b (CYTB).	[51]
Ethidium	DMMEQUR	Investigative	Ethidium decreases the expression of Cytochrome b (CYTB).	[52]

References

• [1] A novel mitochondrial DNA deletion producing progressive external ophthalmoplegia associated with multiple sclerosis.J Clin Neurosci. 2011 Oct;18(10):1318-24. doi: 10.1016/j.jocn.2011.02.019. Epub 2011 Jul 26.
• [2] Detection of bacterial pathogens in clade E head lice collected from Niger's refugees in Algeria.Parasit Vectors. 2018 Jun 15;11(1):348. doi: 10.1186/s13071-018-2930-5.
• [3] The pattern of natural selection in somatic cancer mutations of human mtDNA.J Hum Genet. 2010 Sep;55(9):605-12. doi: 10.1038/jhg.2010.76. Epub 2010 Jul 8.
• [4] Changes of hippocampus proteomic profiles after blueberry extracts supplementation in APP/PS1 transgenic mice.Nutr Neurosci. 2020 Jan;23(1):75-84. doi: 10.1080/1028415X.2018.1471251. Epub 2018 May 21.
• [5] Changes of mitochondria in atherosclerosis: possible determinant in the pathogenesis of the disease.Atherosclerosis. 2013 Apr;227(2):283-8. doi: 10.1016/j.atherosclerosis.2013.01.006. Epub 2013 Jan 25.
• [6] Mitochondrial cytochrome B gene mutation promotes tumor growth in bladder cancer.Cancer Res. 2008 Feb 1;68(3):700-6. doi: 10.1158/0008-5472.CAN-07-5532.
• [7] High incidence of coding gene mutations in mitochondrial DNA in esophageal cancer.Mol Med Rep. 2017 Dec;16(6):8537-8541. doi: 10.3892/mmr.2017.7663. Epub 2017 Sep 29.
• [8] Analysis of mitochondrial DNA heteroplasmic mutations A1555G, C3256T, T3336C, 5178, G12315A, G13513A, G14459A, G14846 and G15059A in CHD patients with the history of myocardial infarction.Exp Mol Pathol. 2016 Feb;100(1):87-91. doi: 10.1016/j.yexmp.2015.12.003. Epub 2015 Dec 3.
• [9] High-resolution melting (HRM) of the cytochrome B gene: a powerful approach to identify blood-meal sources in Chagas disease Vectors.PLoS Negl Trop Dis. 2012;6(2):e1530. doi: 10.1371/journal.pntd.0001530. Epub 2012 Feb 28.
• [10] An outbreak of Leishmania major from an endemic to a non-endemic region posed a public health threat in Iraq from 2014-2017: Epidemiological, molecular and phylogenetic studies.PLoS Negl Trop Dis. 2018 Mar 1;12(3):e0006255. doi: 10.1371/journal.pntd.0006255. eCollection 2018 Mar.
• [11] Mitochondrial DNA variant m.15218A?G in Finnish epilepsy patients who have maternal relatives with epilepsy, sensorineural hearing impairment or diabetes mellitus.BMC Med Genet. 2013 Jul 19;14:73. doi: 10.1186/1471-2350-14-73.
• [12] Cystatin B as a potential diagnostic biomarker in ovarian clear cell carcinoma.Int J Oncol. 2015 Apr;46(4):1573-81. doi: 10.3892/ijo.2015.2858. Epub 2015 Jan 28.
• [13] Identification of tubulin beta chain, thymosin beta-4-like protein 3, and cytochrome b-c?complex subunit 1 as serological diagnostic biomarkers of gastric cancer.Clin Biochem. 2013 Oct;46(15):1578-84. doi: 10.1016/j.clinbiochem.2013.05.068. Epub 2013 Jun 6.
• [14] Mitochondrial miR-181a-5p promotes glucose metabolism reprogramming in liver cancer by regulating the electron transport chain.Carcinogenesis. 2020 Jul 14;41(7):972-983. doi: 10.1093/carcin/bgz174.
• [15] Impact of the mitochondrial genetic background in complex III deficiency.PLoS One. 2010 Sep 17;5(9):e12801. doi: 10.1371/journal.pone.0012801.
• [16] Clinical expression of Leber hereditary optic neuropathy is affected by the mitochondrial DNA-haplogroup background.Am J Hum Genet. 2007 Aug;81(2):228-33. doi: 10.1086/519394. Epub 2007 Jun 4.
• [17] Tumor necrosis factor and immune interferon synergistically induce cytochrome b-245 heavy-chain gene expression and nicotinamide-adenine dinucleotide phosphate hydrogenase oxidase in human leukemic myeloid cells.J Clin Invest. 1989 May;83(5):1570-9. doi: 10.1172/JCI114054.
• [18] CD4+ T-cell response to mitochondrial cytochrome B in human melanoma.Cancer Res. 2006 Jun 1;66(11):5919-26. doi: 10.1158/0008-5472.CAN-05-4574.
• [19] A 4-base pair deletion in the mitochondrial cytochrome b gene associated with parkinsonism/MELAS overlap syndrome.Ann Neurol. 1999 Jan;45(1):130-3. doi: 10.1002/1531-8249(199901)45:1<130::aid-art21>3.3.co;2-q.
• [20] Mitochondrial disease-related mutations at the cytochrome b-iron-sulfur protein (ISP) interface: Molecular effects on the large-scale motion of ISP and superoxide generation studied in Rhodobacter capsulatus cytochrome bc1.Biochim Biophys Acta. 2016 Aug;1857(8):1102-1110. doi: 10.1016/j.bbabio.2016.03.022. Epub 2016 Mar 28.
• [21] Mitochondrial encephalomyopathy and complex III deficiency associated with a stop-codon mutation in the cytochrome b gene.Am J Hum Genet. 2000 Dec;67(6):1400-10. doi: 10.1086/316900. Epub 2000 Oct 20.
• [22] A novel mutation in the mitochondrial DNA cytochrome b gene (MTCYB) in a patient with Prader Willi syndrome.J Child Neurol. 2015 Mar;30(3):378-81. doi: 10.1177/0883073814530499. Epub 2014 Apr 25.
• [23] Myopathy with MTCYB mutation mimicking Multiple Acyl-CoA Dehydrogenase Deficiency.Rev Neurol (Paris). 2018 Dec;174(10):731-735. doi: 10.1016/j.neurol.2018.03.014. Epub 2018 Oct 11.
• [24] Down-regulation of mitochondrial NADH and cytochrome b gene associated with high tumor stages in head and neck squamous cell carcinoma.Arch Oral Biol. 2019 Mar;99:107-112. doi: 10.1016/j.archoralbio.2019.01.005. Epub 2019 Jan 10.
• [25] Mitochondrial deoxyribonucleic acid content is specifically decreased in adult, but not fetal, pancreatic islets of the Goto-Kakizaki rat, a genetic model of noninsulin-dependent diabetes.Endocrinology. 1995 Dec;136(12):5623-31. doi: 10.1210/endo.136.12.7588317.
• [26] Golden mean to longevity: rareness of mitochondrial cytochrome b variants in centenarians but not in patients with Parkinson's disease.J Neurosci Res. 2002 Nov 1;70(3):347-55. doi: 10.1002/jnr.10444.
• [27] An out-of-frame cytochrome b gene deletion from a patient with parkinsonism is associated with impaired complex III assembly and an increase in free radical production.Ann Neurol. 2000 Nov;48(5):774-81.
• [28] Polymorphisms involving the Pneumocystis jirovecii-related genes in AIDS patients in eastern China.Infect Genet Evol. 2019 Nov;75:103955. doi: 10.1016/j.meegid.2019.103955. Epub 2019 Jul 5.
• [29] Effect of experimental thyrotoxicosis on oxidative phosphorylation in rat liver, kidney and brain mitochondria.Mol Cell Endocrinol. 1982 Oct;28(2):173-89. doi: 10.1016/0303-7207(82)90030-2.
• [30] Phenylmethimazole and a thiazole derivative of phenylmethimazole inhibit IL-6 expression by triple negative breast cancer cells.Eur J Pharmacol. 2017 May 15;803:130-137. doi: 10.1016/j.ejphar.2017.03.049. Epub 2017 Mar 23.
• [31] Impact of deprivation, ethnicity, and insulin pump therapy on developmental trajectories of diabetes control in COB type 1 diabetes.Pediatr Diabetes. 2017 Aug;18(5):384-391. doi: 10.1111/pedi.12407. Epub 2016 Aug 18.
• [32] NADPH oxidase p22phox gene expression in ulcerative colitis.Turk J Gastroenterol. 2014 Dec;25(6):634-8. doi: 10.5152/tjg.2014.5926.
• [33] Somatic mosaicism in two unrelated patients with X-linked chronic granulomatous disease characterized by the presence of a small population of normal cells.Gene. 2012 Apr 10;497(1):110-5. doi: 10.1016/j.gene.2012.01.019. Epub 2012 Jan 28.
• [34] A Natural mtDNA Polymorphism in Complex III Is a Modifier of Healthspan in Mice.Int J Mol Sci. 2019 May 13;20(9):2359. doi: 10.3390/ijms20092359.
• [35] Possible implication of the genetic composition of the Lutzomyia longipalpis (Diptera: Psychodidae) populations in the epidemiology of the visceral leishmaniasis.J Med Entomol. 2011 Sep;48(5):1016-22. doi: 10.1603/me10249.
• [36] Evidence for the presence of somatic mitochondrial DNA mutations in right atrial appendage tissues of coronary artery disease patients.Mol Genet Genomics. 2014 Aug;289(4):533-40. doi: 10.1007/s00438-014-0828-2. Epub 2014 Mar 7.
• [37] Multisystem disorder associated with a missense mutation in the mitochondrial cytochrome b gene.Ann Neurol. 2001 Oct;50(4):540-3. doi: 10.1002/ana.1224.
• [38] Functional characterization of novel mutations in the human cytochrome b gene.Eur J Hum Genet. 2001 Jul;9(7):510-8. doi: 10.1038/sj.ejhg.5200678.
• [39] Integrated 'omics analysis reveals new drug-induced mitochondrial perturbations in human hepatocytes. Toxicol Lett. 2018 Jun 1;289:1-13.
• [40] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [41] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [42] Carbon tetrachloride induced mitochondrial division, respiratory chain damage, abnormal intracellular [H(+)] and apoptosis are due to the activation of 5-HT degradation system in hepatocytes. Toxicol Appl Pharmacol. 2022 Mar 15;439:115929. doi: 10.1016/j.taap.2022.115929. Epub 2022 Feb 21.
• [43] Adipocyte differentiation, mitochondrial gene expression and fat distribution: differences between zidovudine and tenofovir after 6 months. Antivir Ther. 2009;14(8):1089-100. doi: 10.3851/IMP1457.
• [44] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [45] Mechanisms of Chronic Fialuridine Hepatotoxicity as Revealed in Primary Human Hepatocyte Spheroids. Toxicol Sci. 2019 Oct 1;171(2):385-395. doi: 10.1093/toxsci/kfz195.
• [46] New insights into BaP-induced toxicity: role of major metabolites in transcriptomics and contribution to hepatocarcinogenesis. Arch Toxicol. 2016 Jun;90(6):1449-58.
• [47] Endoplasmic reticulum stress impairs insulin signaling through mitochondrial damage in SH-SY5Y cells. Neurosignals. 2012;20(4):265-80.
• [48] Bisphenol A Exposure Changes the Transcriptomic and Proteomic Dynamics of Human Retinoblastoma Y79 Cells. Genes (Basel). 2021 Feb 11;12(2):264. doi: 10.3390/genes12020264.
• [49] Transcriptome dynamics of alternative splicing events revealed early phase of apoptosis induced by methylparaben in H1299 human lung carcinoma cells. Arch Toxicol. 2020 Jan;94(1):127-140. doi: 10.1007/s00204-019-02629-w. Epub 2019 Nov 20.
• [50] Role of PARP-1 as a novel transcriptional regulator of MMP-9 in diabetic retinopathy. Biochim Biophys Acta Mol Basis Dis. 2017 Jul;1863(7):1761-1769. doi: 10.1016/j.bbadis.2017.04.024. Epub 2017 May 3.
• [51] Preferential induction of the AhR gene battery in HepaRG cells after a single or repeated exposure to heterocyclic aromatic amines. Toxicol Appl Pharmacol. 2010 Nov 15;249(1):91-100.
• [52] The effect of ethidium bromide and chloramphenicol on mitochondrial biogenesis in primary human fibroblasts. Toxicol Appl Pharmacol. 2012 May 15;261(1):42-9. doi: 10.1016/j.taap.2012.03.009.