Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTBIJ5TI)

DOT Name	Odorant-binding protein 2a (OBP2A)
Synonyms	Odorant-binding protein IIa; OBPIIa
Gene Name	OBP2A
Related Disease	Advanced cancer ( ) Thyroid cancer ( ) Thyroid gland carcinoma ( ) Thyroid tumor ( ) Bipolar disorder ( ) Bladder cancer ( ) Bone osteosarcoma ( ) Breast cancer ( ) Breast carcinoma ( ) Clear cell renal carcinoma ( ) Colonic neoplasm ( ) Colorectal carcinoma ( ) FG syndrome ( ) Head and neck cancer ( ) Head and neck carcinoma ( ) Head-neck squamous cell carcinoma ( ) Hepatocellular carcinoma ( ) Immunodeficiency ( ) Lung cancer ( ) Lung carcinoma ( ) Lung neoplasm ( ) Malignant soft tissue neoplasm ( ) Neoplasm ( ) Osteosarcoma ( ) Parkinson disease ( ) Prostate carcinoma ( ) Prostate neoplasm ( ) Renal cell carcinoma ( ) Rhabdomyosarcoma ( ) Sarcoma ( ) Urinary bladder cancer ( ) Urinary bladder neoplasm ( ) Adenovirus infection ( ) Prostate cancer ( ) Small-cell lung cancer ( ) Non-small-cell lung cancer ( ) Aplasia cutis congenita ( ) Corpus callosum, agenesis of ( ) Hyperglycemia ( ) Mesothelioma ( ) Triple negative breast cancer ( )
UniProt ID	OBP2A_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
PDB ID	4RUN
Pfam ID	PF00061
Sequence	MKTLFLGVTLGLAAALSFTLEEEDITGTWYVKAMVVDKDFPEDRRPRKVSPVKVTALGGG NLEATFTFMREDRCIQKKILMRKTEEPGKFSAYGGRKLIYLQELPGTDDYVFYCKDQRRG GLRYMGKLVGRNPNTNLEALEEFKKLVQHKGLSEEDIFMPLQTGSCVLEH
Function	Binds and transports small hydrophobic volatile molecules with a higher affinity for aldehydes and large fatty acids, including undecanal, palmitic acid, efficient aldehydes, benzenic aldehydes, heterocyclic aldehydes and aliphatic acids.
Tissue Specificity	Strongly expressed in the nasal structures, salivary and lachrymal glands, and lung . Expressed in the liver .

Molecular Interaction Atlas (MIA) of This DOT

41 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance
Advanced cancer	DISAT1Z9	Definitive	Biomarker	[1]
Thyroid cancer	DIS3VLDH	Definitive	Biomarker	[2]
Thyroid gland carcinoma	DISMNGZ0	Definitive	Biomarker	[2]
Thyroid tumor	DISLVKMD	Definitive	Biomarker	[2]
Bipolar disorder	DISAM7J2	Strong	Biomarker	[3]
Bladder cancer	DISUHNM0	Strong	Biomarker	[4]
Bone osteosarcoma	DIST1004	Strong	Biomarker	[5]
Breast cancer	DIS7DPX1	Strong	Biomarker	[6]
Breast carcinoma	DIS2UE88	Strong	Biomarker	[6]
Clear cell renal carcinoma	DISBXRFJ	Strong	Biomarker	[7]
Colonic neoplasm	DISSZ04P	Strong	Genetic Variation	[8]
Colorectal carcinoma	DIS5PYL0	Strong	Biomarker	[2]
FG syndrome	DIS2MEFU	Strong	Biomarker	[9]
Head and neck cancer	DISBPSQZ	Strong	Biomarker	[10]
Head and neck carcinoma	DISOU1DS	Strong	Biomarker	[10]
Head-neck squamous cell carcinoma	DISF7P24	Strong	Biomarker	[11]
Hepatocellular carcinoma	DIS0J828	Strong	Biomarker	[12]
Immunodeficiency	DIS093I0	Strong	Altered Expression	[13]
Lung cancer	DISCM4YA	Strong	Biomarker	[14]
Lung carcinoma	DISTR26C	Strong	Biomarker	[14]
Lung neoplasm	DISVARNB	Strong	Biomarker	[15]
Malignant soft tissue neoplasm	DISTC6NO	Strong	Biomarker	[16]
Neoplasm	DISZKGEW	Strong	Biomarker	[17]
Osteosarcoma	DISLQ7E2	Strong	Biomarker	[5]
Parkinson disease	DISQVHKL	Strong	Genetic Variation	[18]
Prostate carcinoma	DISMJPLE	Strong	Biomarker	[19]
Prostate neoplasm	DISHDKGQ	Strong	Genetic Variation	[20]
Renal cell carcinoma	DISQZ2X8	Strong	Biomarker	[7]
Rhabdomyosarcoma	DISNR7MS	Strong	Biomarker	[21]
Sarcoma	DISZDG3U	Strong	Biomarker	[16]
Urinary bladder cancer	DISDV4T7	Strong	Biomarker	[4]
Urinary bladder neoplasm	DIS7HACE	Strong	Biomarker	[4]
Adenovirus infection	DISUYSBZ	moderate	Biomarker	[17]
Prostate cancer	DISF190Y	moderate	Biomarker	[19]
Small-cell lung cancer	DISK3LZD	moderate	Genetic Variation	[22]
Non-small-cell lung cancer	DIS5Y6R9	Disputed	Altered Expression	[23]
Aplasia cutis congenita	DISMDAYM	Limited	Biomarker	[24]
Corpus callosum, agenesis of	DISO9P40	Limited	Biomarker	[24]
Hyperglycemia	DIS0BZB5	Limited	Altered Expression	[25]
Mesothelioma	DISKWK9M	Limited	Biomarker	[26]
Triple negative breast cancer	DISAMG6N	Limited	Biomarker	[27]
------------------------------------------------------------------------------------


⏷ Show the Full List of 41 Disease(s)

Molecular Interaction Atlas (MIA)

MIA Detail

Jump to Detail Molecular Interaction Atlas of This DOT

3 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Odorant-binding protein 2a (OBP2A).	[28]
Fulvestrant	DM0YZC6	Approved	Fulvestrant increases the methylation of Odorant-binding protein 2a (OBP2A).	[30]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of Odorant-binding protein 2a (OBP2A).	[31]
------------------------------------------------------------------------------------

2 Drug(s) Affected the Protein Interaction/Cellular Processes of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Tretinoin	DM49DUI	Approved	Tretinoin affects the binding of Odorant-binding protein 2a (OBP2A).	[29]
1-anilinonaphthalene-8-sulfonic acid	DMNGY0E	Investigative	1-anilinonaphthalene-8-sulfonic acid affects the binding of Odorant-binding protein 2a (OBP2A).	[29]
------------------------------------------------------------------------------------

References

1	OBP-401-GFP telomerase-dependent adenovirus illuminates and kills high-metastatic more effectively than low-metastatic triple-negative breast cancer in vitro.Cancer Gene Ther. 2017 Feb;24(2):45-47. doi: 10.1038/cgt.2016.67. Epub 2017 Jan 20.
2	Comprehensive Exploration to Identify Predictive DNA Markers of Np63/SOX2 in Drug Resistance in Human Esophageal Squamous Cell Carcinoma.Ann Surg Oncol. 2019 Dec;26(13):4814-4825. doi: 10.1245/s10434-019-07795-w. Epub 2019 Sep 16.
3	White matter - emotion processing activity relationships in youth offspring of bipolar parents.J Affect Disord. 2019 Jan 15;243:153-164. doi: 10.1016/j.jad.2018.09.010. Epub 2018 Sep 11.
4	A Histone Deacetylase Inhibitor, OBP-801, and Celecoxib Synergistically Inhibit the Cell Growth with Apoptosis via a DR5-Dependent Pathway in Bladder Cancer Cells.Mol Cancer Ther. 2016 Sep;15(9):2066-75. doi: 10.1158/1535-7163.MCT-16-0010. Epub 2016 Jul 12.
5	Role of zoledronic acid in oncolytic virotherapy: Promotion of antitumor effect and prevention of bone destruction.Cancer Sci. 2017 Sep;108(9):1870-1880. doi: 10.1111/cas.13316. Epub 2017 Aug 3.
6	A novel approach using telomerase-specific replication-selective adenovirus for detection of circulating tumor cells in breast cancer patients.Breast Cancer Res Treat. 2011 Aug;128(3):765-73. doi: 10.1007/s10549-011-1603-2. Epub 2011 Jun 1.
7	A novel HDAC inhibitor OBP-801 and a PI3K inhibitor LY294002 synergistically induce apoptosis via the suppression of survivin and XIAP in renal cell carcinoma.Int J Oncol. 2013 Oct;43(4):1080-6. doi: 10.3892/ijo.2013.2042. Epub 2013 Jul 30.
8	Visualization of intrathoracically disseminated solid tumors in mice with optical imaging by telomerase-specific amplification of a transferred green fluorescent protein gene.Cancer Res. 2004 Sep 1;64(17):6259-65. doi: 10.1158/0008-5472.CAN-04-1335.
9	Eradication of osteosarcoma by fluorescence-guided surgery with tumor labeling by a killer-reporter adenovirus.J Orthop Res. 2016 May;34(5):836-44. doi: 10.1002/jor.23073. Epub 2015 Nov 3.
10	Use of telomelysin (OBP-301) in mouse xenografts of human head and neck cancer.Oncol Rep. 2009 Nov;22(5):1039-43. doi: 10.3892/or_00000533.
11	Telomerase-specific oncolytic adenovirus: antitumor effects on radiation-resistant head and neck squamous cell carcinoma cells.Head Neck. 2014 Mar;36(3):411-8. doi: 10.1002/hed.23309. Epub 2013 Jun 1.
12	Selective metastatic tumor labeling with green fluorescent protein and killing by systemic administration of telomerase-dependent adenoviruses.Mol Cancer Ther. 2009 Nov;8(11):3001-8. doi: 10.1158/1535-7163.MCT-09-0556. Epub 2009 Nov 3.
13	Telomerase-specific virotherapy in an animal model of human head and neck cancer.Mol Cancer Ther. 2009 Jan;8(1):171-7. doi: 10.1158/1535-7163.MCT-08-0620.
14	Enhanced antitumor efficacy of telomerase-specific oncolytic adenovirus with valproic acid against human cancer cells.Cancer Gene Ther. 2012 Nov;19(11):767-72. doi: 10.1038/cgt.2012.57. Epub 2012 Sep 7.
15	Preclinical evaluation of differentially targeting dual virotherapy for human solid cancer.Mol Cancer Ther. 2010 Jun;9(6):1884-93. doi: 10.1158/1535-7163.MCT-10-0205. Epub 2010 May 25.
16	Preclinical evaluation of telomerase-specific oncolytic virotherapy for human bone and soft tissue sarcomas.Clin Cancer Res. 2011 Apr 1;17(7):1828-38. doi: 10.1158/1078-0432.CCR-10-2066. Epub 2011 Feb 16.
17	Therapeutic Cell-Cycle-Decoy Efficacy of a Telomerase-Dependent Adenovirus in an Orthotopic Model of Chemotherapy-Resistant Human Stomach Carcinomatosis Peritonitis Visualized With FUCCI Imaging.J Cell Biochem. 2017 Nov;118(11):3635-3642. doi: 10.1002/jcb.25593. Epub 2017 Jul 31.
18	Odor Identification Performance in Idiopathic Parkinson's Disease Is Associated With Gender and the Genetic Variability of the Olfactory Binding Protein.Chem Senses. 2019 May 29;44(5):311-318. doi: 10.1093/chemse/bjz020.
19	Histone Deacetylase Inhibition in Prostate Cancer Triggers miR-320-Mediated Suppression of the Androgen Receptor.Cancer Res. 2016 Jul 15;76(14):4192-204. doi: 10.1158/0008-5472.CAN-15-3339. Epub 2016 May 23.
20	Direct and distant antitumor effects of a telomerase-selective oncolytic adenoviral agent, OBP-301, in a mouse prostate cancer model.Cancer Gene Ther. 2008 May;15(5):315-22. doi: 10.1038/cgt.2008.3. Epub 2008 Feb 15.
21	[Erratum] OBP?01, a novel histone deacetylase inhibitor, induces Mphase arrest and apoptosis in rhabdomyosarcoma cells.Oncol Rep. 2019 Apr;41(4):2601. doi: 10.3892/or.2019.6997. Epub 2019 Feb 1.
22	Detection and preliminary evaluation of circulating tumor cells in the peripheral blood of patients with eight types of cancer using a telomerase-specific adenovirus.Oncol Rep. 2014 Nov;32(5):1772-8. doi: 10.3892/or.2014.3436. Epub 2014 Aug 22.
23	Histone deacetylase inhibitor FR901228 enhances the antitumor effect of telomerase-specific replication-selective adenoviral agent OBP-301 in human lung cancer cells.Exp Cell Res. 2006 Feb 1;312(3):256-65. doi: 10.1016/j.yexcr.2005.10.026. Epub 2005 Dec 13.
24	Antitumor effects of telomerase-specific replication-selective oncolytic viruses for adenoid cystic carcinoma cell lines.Oncol Rep. 2013 Dec;30(6):2659-64. doi: 10.3892/or.2013.2738. Epub 2013 Sep 19.
25	Control of diabetic hyperglycaemia and insulin resistance through TSC22D4.Nat Commun. 2016 Nov 9;7:13267. doi: 10.1038/ncomms13267.
26	A novel translational approach for human malignant pleural mesothelioma: heparanase-assisted dual virotherapy.Oncogene. 2010 Feb 25;29(8):1145-54. doi: 10.1038/onc.2009.415. Epub 2009 Nov 23.
27	The histone deacetylase inhibitor OBP-801 and eribulin synergistically inhibit the growth of triple-negative breast cancer cells with the suppression of survivin, Bcl-xL, and the MAPK pathway.Breast Cancer Res Treat. 2018 Aug;171(1):43-52. doi: 10.1007/s10549-018-4815-x. Epub 2018 May 11.
28	Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
29	Comparative ligand-binding analysis of ten human lipocalins. Biochim Biophys Acta. 2006 Feb;1764(2):161-73. doi: 10.1016/j.bbapap.2005.12.006. Epub 2006 Jan 6.
30	DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
31	Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.