Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTC5WP98)

• DOT Name: Serine/arginine-rich splicing factor 5 (SRSF5)
• Synonyms: Delayed-early protein HRS; Pre-mRNA-splicing factor SRP40; Splicing factor, arginine/serine-rich 5
• Gene Name: SRSF5
• Related Disease:
  Adenocarcinoma
  Advanced cancer
  Allergic rhinitis
  Alzheimer disease
  Arrhythmia
  Atrial fibrillation
  Autosomal dominant vitreoretinochoroidopathy
  Breast cancer
  Breast carcinoma
  Breast neoplasm
  Brugada syndrome
  Cardiomyopathy
  Classic Hodgkin lymphoma
  Colon carcinoma
  Dementia
  Depression
  Diabetic macular edema
  Familial long QT syndrome
  Germ cell tumor
  Hepatitis C virus infection
  Hepatocellular carcinoma
  Hutchinson-Gilford progeria syndrome
  Liver cirrhosis
  Lung carcinoma
  Metastatic malignant neoplasm
  Myositis disease
  Neoplasm
  Non-insulin dependent diabetes
  Non-small-cell lung cancer
  Peripheral arterial disease
  Pleural disease
  Premature aging syndrome
  Prostate cancer
  Prostate carcinoma
  Small-cell lung cancer
  Squamous cell carcinoma
  Systemic lupus erythematosus
  Vitelliform macular dystrophy
  X-linked reticulate pigmentary disorder
  Alcohol dependence
  Schwannoma
  Generalized anxiety disorder
  Lung cancer
  Neurofibromatosis type 2
  Type-1 diabetes
  Type-1/2 diabetes
• UniProt ID: SRSF5_HUMAN
• Pfam ID: PF00076
• Sequence:
  MSGCRVFIGRLNPAAREKDVERFFKGYGRIRDIDLKRGFGFVEFEDPRDADDAVYELDGK
  ELCSERVTIEHARARSRGGRGRGRYSDRFSSRRPRNDRRNAPPVRTENRLIVENLSSRVS
  WQDLKDFMRQAGEVTFADAHRPKLNEGVVEFASYGDLKNAIEKLSGKEINGRKIKLIEGS
  KRHSRSRSRSRSRTRSSSRSRSRSRSRSRKSYSRSRSRSRSRSRSKSRSVSRSPVPEKSQ
  KRGSSSRSKSPASVDRQRSRSRSRSRSVDSGN
• Function: Plays a role in constitutive splicing and can modulate the selection of alternative splice sites.
• KEGG Pathway:
  Spliceosome (hsa03040)
  Herpes simplex virus 1 infection (hsa05168)
• Reactome Pathway:
  mRNA Splicing - Major Pathway (R-HSA-72163)
  mRNA 3'-end processing (R-HSA-72187)
  Processing of Capped Intron-Containing Pre-mRNA (R-HSA-72203)
  RNA Polymerase II Transcription Termination (R-HSA-73856)
  Transport of Mature mRNA derived from an Intron-Containing Transcript (R-HSA-159236)

Molecular Interaction Atlas (MIA) of This DOT

46 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Adenocarcinoma	DIS3IHTY	Strong	Altered Expression	[1]
Advanced cancer	DISAT1Z9	Strong	Genetic Variation	[2]
Allergic rhinitis	DIS3U9HN	Strong	Altered Expression	[3]
Alzheimer disease	DISF8S70	Strong	Genetic Variation	[4]
Arrhythmia	DISFF2NI	Strong	Altered Expression	[5]
Atrial fibrillation	DIS15W6U	Strong	Biomarker	[6]
Autosomal dominant vitreoretinochoroidopathy	DISXZJ1T	Strong	Biomarker	[7]
Breast cancer	DIS7DPX1	Strong	Altered Expression	[8]
Breast carcinoma	DIS2UE88	Strong	Altered Expression	[8]
Breast neoplasm	DISNGJLM	Strong	Altered Expression	[8]
Brugada syndrome	DISSGN0E	Strong	Biomarker	[9]
Cardiomyopathy	DISUPZRG	Strong	Biomarker	[10]
Classic Hodgkin lymphoma	DISV1LU6	Strong	Biomarker	[11]
Colon carcinoma	DISJYKUO	Strong	Biomarker	[12]
Dementia	DISXL1WY	Strong	Genetic Variation	[4]
Depression	DIS3XJ69	Strong	Biomarker	[13]
Diabetic macular edema	DIS162FN	Strong	Biomarker	[14]
Familial long QT syndrome	DISRNNCY	Strong	Biomarker	[9]
Germ cell tumor	DIS62070	Strong	Altered Expression	[15]
Hepatitis C virus infection	DISQ0M8R	Strong	Biomarker	[16]
Hepatocellular carcinoma	DIS0J828	Strong	Altered Expression	[17]
Hutchinson-Gilford progeria syndrome	DISY55BU	Strong	Altered Expression	[18]
Liver cirrhosis	DIS4G1GX	Strong	Genetic Variation	[19]
Lung carcinoma	DISTR26C	Strong	Altered Expression	[20]
Metastatic malignant neoplasm	DIS86UK6	Strong	Biomarker	[1]
Myositis disease	DISCIXF0	Strong	Biomarker	[21]
Neoplasm	DISZKGEW	Strong	Altered Expression	[22]
Non-insulin dependent diabetes	DISK1O5Z	Strong	Biomarker	[23]
Non-small-cell lung cancer	DIS5Y6R9	Strong	Biomarker	[20]
Peripheral arterial disease	DIS78WFB	Strong	Biomarker	[24]
Pleural disease	DISHT9AE	Strong	Altered Expression	[1]
Premature aging syndrome	DIS51AGT	Strong	Altered Expression	[18]
Prostate cancer	DISF190Y	Strong	Genetic Variation	[25]
Prostate carcinoma	DISMJPLE	Strong	Genetic Variation	[25]
Small-cell lung cancer	DISK3LZD	Strong	Biomarker	[20]
Squamous cell carcinoma	DISQVIFL	Strong	Altered Expression	[22]
Systemic lupus erythematosus	DISI1SZ7	Strong	Biomarker	[26]
Vitelliform macular dystrophy	DISEFYYN	Strong	Biomarker	[7]
X-linked reticulate pigmentary disorder	DIS0RB5A	Strong	Genetic Variation	[27]
Alcohol dependence	DIS4ZSCO	moderate	Genetic Variation	[28]
Schwannoma	DISTTVLA	moderate	Altered Expression	[29]
Generalized anxiety disorder	DISPSQCW	Limited	Biomarker	[30]
Lung cancer	DISCM4YA	Limited	Altered Expression	[20]
Neurofibromatosis type 2	DISI8ECS	Limited	Biomarker	[31]
Type-1 diabetes	DIS7HLUB	Limited	Biomarker	[32]
Type-1/2 diabetes	DISIUHAP	Limited	Biomarker	[33]

21 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Serine/arginine-rich splicing factor 5 (SRSF5).	[34]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Serine/arginine-rich splicing factor 5 (SRSF5).	[35]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Serine/arginine-rich splicing factor 5 (SRSF5).	[36]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of Serine/arginine-rich splicing factor 5 (SRSF5).	[37]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Serine/arginine-rich splicing factor 5 (SRSF5).	[38]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Serine/arginine-rich splicing factor 5 (SRSF5).	[39]
Arsenic	DMTL2Y1	Approved	Arsenic increases the expression of Serine/arginine-rich splicing factor 5 (SRSF5).	[40]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide increases the expression of Serine/arginine-rich splicing factor 5 (SRSF5).	[41]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide decreases the expression of Serine/arginine-rich splicing factor 5 (SRSF5).	[42]
Marinol	DM70IK5	Approved	Marinol increases the expression of Serine/arginine-rich splicing factor 5 (SRSF5).	[43]
Clozapine	DMFC71L	Approved	Clozapine increases the expression of Serine/arginine-rich splicing factor 5 (SRSF5).	[44]
Benzatropine	DMF7EXL	Approved	Benzatropine increases the expression of Serine/arginine-rich splicing factor 5 (SRSF5).	[44]
Urethane	DM7NSI0	Phase 4	Urethane decreases the expression of Serine/arginine-rich splicing factor 5 (SRSF5).	[45]
Curcumin	DMQPH29	Phase 3	Curcumin decreases the expression of Serine/arginine-rich splicing factor 5 (SRSF5).	[46]
Phenol	DM1QSM3	Phase 2/3	Phenol decreases the expression of Serine/arginine-rich splicing factor 5 (SRSF5).	[47]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of Serine/arginine-rich splicing factor 5 (SRSF5).	[48]
Leflunomide	DMR8ONJ	Phase 1 Trial	Leflunomide decreases the expression of Serine/arginine-rich splicing factor 5 (SRSF5).	[49]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Serine/arginine-rich splicing factor 5 (SRSF5).	[50]
chloropicrin	DMSGBQA	Investigative	chloropicrin increases the expression of Serine/arginine-rich splicing factor 5 (SRSF5).	[51]
Nickel chloride	DMI12Y8	Investigative	Nickel chloride decreases the expression of Serine/arginine-rich splicing factor 5 (SRSF5).	[53]
Resorcinol	DMM37C0	Investigative	Resorcinol increases the expression of Serine/arginine-rich splicing factor 5 (SRSF5).	[54]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Paraquat	DMR8O3X	Investigative	Paraquat increases the phosphorylation of Serine/arginine-rich splicing factor 5 (SRSF5).	[52]

References

• [1] SRSF5: a novel marker for small-cell lung cancer and pleural metastatic cancer.Lung Cancer. 2016 Sep;99:57-65. doi: 10.1016/j.lungcan.2016.05.018. Epub 2016 May 26.
• [2] Time trends in the prevalence of cancer and non-cancer diseases among older U.S. adults: Medicare-based analysis.Exp Gerontol. 2018 Sep;110:267-276. doi: 10.1016/j.exger.2018.06.017. Epub 2018 Jun 19.
• [3] Hydrogen-rich saline attenuates eosinophil activation in a guinea pig model of allergic rhinitis via reducing oxidative stress.J Inflamm (Lond). 2017 Jan 13;14:1. doi: 10.1186/s12950-016-0148-x. eCollection 2017.
• [4] Genetically predicted body mass index and Alzheimer's disease-related phenotypes in three large samples: Mendelian randomization analyses.Alzheimers Dement. 2015 Dec;11(12):1439-1451. doi: 10.1016/j.jalz.2015.05.015. Epub 2015 Jun 12.
• [5] Arrhythmias in congenital heart disease: a position paper of the European Heart Rhythm Association (EHRA), Association for European Paediatric and Congenital Cardiology (AEPC), and the European Society of Cardiology (ESC) Working Group on Grown-up Congenital heart disease, endorsed by HRS, PACES, APHRS, and SOLAECE.Europace. 2018 Nov 1;20(11):1719-1753. doi: 10.1093/europace/eux380.
• [6] Oral anticoagulant therapy in adults with congenital heart disease and atrial arrhythmias: Implementation of guidelines.Int J Cardiol. 2018 Apr 15;257:67-74. doi: 10.1016/j.ijcard.2017.12.038.
• [7] ADVIRC is caused by distinct mutations in BEST1 that alter pre-mRNA splicing. J Med Genet. 2009 Sep;46(9):620-5. doi: 10.1136/jmg.2008.059881. Epub 2008 Jul 8.
• [8] Increased expression of SRp40 affecting CD44 splicing is associated with the clinical outcome of lymph node metastasis in human breast cancer.Clin Chim Acta. 2007 Sep;384(1-2):69-74. doi: 10.1016/j.cca.2007.06.001. Epub 2007 Jun 15.
• [9] Update of diagnosis and management of inherited cardiac arrhythmias.Circ J. 2013;77(12):2867-72. doi: 10.1253/circj.cj-13-1217. Epub 2013 Nov 7.
• [10] 2019 HRS expert consensus statement on evaluation, risk stratification, and management of arrhythmogenic cardiomyopathy: Executive summary.Heart Rhythm. 2019 Nov;16(11):e373-e407. doi: 10.1016/j.hrthm.2019.09.019.
• [11] Hodgkin lymphoma and Epstein-Barr virus (EBV): no evidence to support hit-and-run mechanism in cases classified as non-EBV-associated.Int J Cancer. 2003 May 1;104(5):624-30. doi: 10.1002/ijc.10979.
• [12] Adenovirus-mediated ribonucleotide reductase R1 gene therapy of human colon adenocarcinoma.Clin Cancer Res. 2003 Oct 1;9(12):4553-61.
• [13] Childlessness and Health Among Older Adults: Variation Across Five Outcomes and 20 Countries.J Gerontol B Psychol Sci Soc Sci. 2021 Jan 18;76(2):348-359. doi: 10.1093/geronb/gbz153.
• [14] Imaging retinal inflammatory biomarkers after intravitreal steroid and anti-VEGF treatment in diabetic macular oedema.Acta Ophthalmol. 2017 Aug;95(5):464-471. doi: 10.1111/aos.13294. Epub 2016 Oct 24.
• [15] TRPV4-dependent induction of a novel mammalian cold-inducible protein SRSF5 as well as CIRP and RBM3.Sci Rep. 2017 May 23;7(1):2295. doi: 10.1038/s41598-017-02473-x.
• [16] Utility of a one-step screening and diagnosis strategy for viremic HCV infection among people who inject drugs in Catalonia.Int J Drug Policy. 2019 Dec;74:236-245. doi: 10.1016/j.drugpo.2019.10.012. Epub 2019 Nov 6.
• [17] Identification of important long non-coding RNAs and highly recurrent aberrant alternative splicing events in hepatocellular carcinoma through integrative analysis of multiple RNA-Seq datasets.Mol Genet Genomics. 2016 Jun;291(3):1035-51. doi: 10.1007/s00438-015-1163-y. Epub 2015 Dec 28.
• [18] Enhanced SRSF5 Protein Expression Reinforces Lamin A mRNA Production in HeLa Cells and Fibroblasts of Progeria Patients.Hum Mutat. 2016 Mar;37(3):280-91. doi: 10.1002/humu.22945. Epub 2016 Jan 12.
• [19] Circulating miR-21, miR-210 and miR-146a as potential biomarkers to differentiate acute tubular necrosis from hepatorenal syndrome in patients with liver cirrhosis: a pilot study.Clin Chem Lab Med. 2018 Apr 25;56(5):739-747. doi: 10.1515/cclm-2017-0483.
• [20] Antitumor activity of SR splicing-factor 5 knockdown by downregulating pyruvate kinase M2 in non-small cell lung cancer cells.J Cell Biochem. 2019 Oct;120(10):17303-17311. doi: 10.1002/jcb.28992. Epub 2019 May 20.
• [21] Myositis induced by naked DNA immunization with the gene for histidyl-tRNA synthetase.Hum Gene Ther. 1997 Aug 10;8(12):1469-80. doi: 10.1089/hum.1997.8.12-1469.
• [22] SRSF5 functions as a novel oncogenic splicing factor and is upregulated by oncogene SRSF3 in oral squamous cell carcinoma.Biochim Biophys Acta Mol Cell Res. 2018 Sep;1865(9):1161-1172. doi: 10.1016/j.bbamcr.2018.05.017. Epub 2018 May 30.
• [23] Attenuation of metabolic syndrome in the ob/ob mouse model by resistant starch intervention is dose dependent.Food Funct. 2019 Dec 11;10(12):7940-7951. doi: 10.1039/c9fo01771b.
• [24] Angiotensin type 1 receptor expression and interleukin-8 production in polymorphonuclear leukocytes of patients with peripheral arterial disease.J Cardiovasc Pharmacol. 2009 Dec;54(6):520-5. doi: 10.1097/FJC.0b013e3181bfadfd.
• [25] A germline DNA polymorphism enhances alternative splicing of the KLF6 tumor suppressor gene and is associated with increased prostate cancer risk.Cancer Res. 2005 Feb 15;65(4):1213-22. doi: 10.1158/0008-5472.CAN-04-4249.
• [26] Expression of glucocorticoid receptor isoforms and associations with serine/arginine-rich protein 30c and 40 in patients with systemic lupus erythematosus.Clin Exp Rheumatol. 2015 Mar-Apr;33(2):225-33. Epub 2015 Feb 9.
• [27] Splicing factor polymorphisms, the control of VEGF isoforms and association with angiogenic eye disease.Curr Eye Res. 2011 Apr;36(4):328-35. doi: 10.3109/02713683.2010.548892. Epub 2011 Feb 10.
• [28] The implications of DSM-III personality disorders for patients with major depression.J Affect Disord. 1984 Dec;7(3-4):309-18. doi: 10.1016/0165-0327(84)90052-1.
• [29] Functional analysis of the relationship between the neurofibromatosis 2 tumor suppressor and its binding partner, hepatocyte growth factor-regulated tyrosine kinase substrate.Hum Mol Genet. 2002 Dec 1;11(25):3167-78. doi: 10.1093/hmg/11.25.3167.
• [30] Factor structure, reliability, and validity of the Japanese version of the Hoarding Rating Scale-Self-Report (HRS-SR-J).Neuropsychiatr Dis Treat. 2017 May 9;13:1235-1243. doi: 10.2147/NDT.S133471. eCollection 2017.
• [31] Neurofibromatosis 2 (NF2) tumor suppressor schwannomin and its interacting protein HRS regulate STAT signaling.Hum Mol Genet. 2002 Dec 1;11(25):3179-89. doi: 10.1093/hmg/11.25.3179.
• [32] Investigation of coordination and order in transcription regulation of innate and adaptive immunity genes in type 1 diabetes.BMC Med Genomics. 2017 Jan 31;10(1):7. doi: 10.1186/s12920-017-0243-8.
• [33] Hydrogen-rich saline prevents bone loss in diabetic rats induced by streptozotocin.Int Orthop. 2017 Oct;41(10):2119-2128. doi: 10.1007/s00264-017-3581-4. Epub 2017 Jul 26.
• [34] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [35] Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
• [36] Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
• [37] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [38] Pleiotropic combinatorial transcriptomes of human breast cancer cells exposed to mixtures of dietary phytoestrogens. Food Chem Toxicol. 2009 Apr;47(4):787-95.
• [39] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [40] Activation of inflammation/NF-kappaB signaling in infants born to arsenic-exposed mothers. PLoS Genet. 2007 Nov;3(11):e207.
• [41] [Construction of subtracted cDNA library in human Jurkat T cell line induced by arsenic trioxide in vitro]. Zhonghua Yu Fang Yi Xue Za Zhi. 2003 Nov;37(6):403-7.
• [42] Hydrogen peroxide triggers a novel alternative splicing of arsenic (+3?oxidation state) methyltransferase gene. Biochem Biophys Res Commun. 2016 Nov 4;480(1):18-22. doi: 10.1016/j.bbrc.2016.10.016. Epub 2016 Oct 6.
• [43] JunD is involved in the antiproliferative effect of Delta9-tetrahydrocannabinol on human breast cancer cells. Oncogene. 2008 Aug 28;27(37):5033-44.
• [44] Cannabidiol Displays Proteomic Similarities to Antipsychotics in Cuprizone-Exposed Human Oligodendrocytic Cell Line MO3.13. Front Mol Neurosci. 2021 May 28;14:673144. doi: 10.3389/fnmol.2021.673144. eCollection 2021.
• [45] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [46] Curcumin downregulates the inflammatory cytokines CXCL1 and -2 in breast cancer cells via NFkappaB. Carcinogenesis. 2008 Apr;29(4):779-89.
• [47] Classification of heavy-metal toxicity by human DNA microarray analysis. Environ Sci Technol. 2007 May 15;41(10):3769-74.
• [48] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [49] Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
• [50] Bisphenol A induces DSB-ATM-p53 signaling leading to cell cycle arrest, senescence, autophagy, stress response, and estrogen release in human fetal lung fibroblasts. Arch Toxicol. 2018 Apr;92(4):1453-1469.
• [51] Transcriptomic analysis of human primary bronchial epithelial cells after chloropicrin treatment. Chem Res Toxicol. 2015 Oct 19;28(10):1926-35.
• [52] Paraquat modulates alternative pre-mRNA splicing by modifying the intracellular distribution of SRPK2. PLoS One. 2013 Apr 16;8(4):e61980. doi: 10.1371/journal.pone.0061980. Print 2013.
• [53] The contact allergen nickel triggers a unique inflammatory and proangiogenic gene expression pattern via activation of NF-kappaB and hypoxia-inducible factor-1alpha. J Immunol. 2007 Mar 1;178(5):3198-207.
• [54] A transcriptomics-based in vitro assay for predicting chemical genotoxicity in vivo. Carcinogenesis. 2012 Jul;33(7):1421-9.