Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTCCYIQJ)

• DOT Name: Metastasis-associated protein MTA2 (MTA2)
• Synonyms: Metastasis-associated 1-like 1; MTA1-L1 protein; p53 target protein in deacetylase complex
• Gene Name: MTA2
• Related Disease:
  Hyperglycemia
  Matthew-Wood syndrome
  Attention deficit hyperactivity disorder
  Bipolar disorder
  Bladder cancer
  Brain neoplasm
  Breast cancer
  Breast carcinoma
  Breast neoplasm
  Common variable immunodeficiency
  Endometriosis
  Gastric cancer
  Glioma
  Gonorrhea
  Hepatitis B virus infection
  Inflammatory bowel disease
  Lung cancer
  Lung carcinoma
  Mental disorder
  Non-small-cell lung cancer
  Oral cancer
  Pancreatic ductal carcinoma
  Stomach cancer
  Systemic lupus erythematosus
  Trichomoniasis
  Urinary bladder cancer
  Urinary bladder neoplasm
  Clear cell renal carcinoma
  Hepatocellular carcinoma
  High blood pressure
  Kidney cancer
  Pelvic inflammatory disease
  Plasma cell myeloma
  Renal carcinoma
  Renal cell carcinoma
  Triple negative breast cancer
  Carcinoma
  Cervical cancer
  Cervical carcinoma
  Chronic obstructive pulmonary disease
  Complement deficiency
  Malignant pleural mesothelioma
  Metastatic malignant neoplasm
  Pancreatic cancer
• UniProt ID: MTA2_HUMAN
• Pfam ID: PF01426 ; PF01448 ; PF00320 ; PF17226 ; PF00249
• Sequence:
  MAANMYRVGDYVYFENSSSNPYLVRRIEELNKTANGNVEAKVVCLFRRRDISSSLNSLAD
  SNAREFEEESKQPGVSEQQRHQLKHRELFLSRQFESLPATHIRGKCSVTLLNETDILSQY
  LEKEDCFFYSLVFDPVQKTLLADQGEIRVGCKYQAEIPDRLVEGESDNRNQQKMEMKVWD
  PDNPLTDRQIDQFLVVARAVGTFARALDCSSSIRQPSLHMSAAAASRDITLFHAMDTLQR
  NGYDLAKAMSTLVPQGGPVLCRDEMEEWSASEAMLFEEALEKYGKDFNDIRQDFLPWKSL
  ASIVQFYYMWKTTDRYIQQKRLKAAEADSKLKQVYIPTYTKPNPNQIISVGSKPGMNGAG
  FQKGLTCESCHTTQSAQWYAWGPPNMQCRLCASCWIYWKKYGGLKTPTQLEGATRGTTEP
  HSRGHLSRPEAQSLSPYTTSANRAKLLAKNRQTFLLQTTKLTRLARRMCRDLLQPRRAAR
  RPYAPINANAIKAECSIRLPKAAKTPLKIHPLVRLPLATIVKDLVAQAPLKPKTPRGTKT
  PINRNQLSQNRGLGGIMVKRAYETMAGAGVPFSANGRPLASGIRSSSQPAAKRQKLNPAD
  APNPVVFVATKDTRALRKALTHLEMRRAARRPNLPLKVKPTLIAVRPPVPLPAPSHPAST
  NEPIVLED
• Function: May function as a transcriptional coregulator. Acts as a component of the histone deacetylase NuRD complex which participates in the remodeling of chromatin.
• Tissue Specificity: Widely expressed.
• KEGG Pathway: ATP-dependent chromatin remodeling (hsa03082)
• Reactome Pathway:
  ERCC6 (CSB) and EHMT2 (G9a) positively regulate rRNA expression (R-HSA-427389)
  Regulation of TP53 Activity through Acetylation (R-HSA-6804758)
  RNA Polymerase I Transcription Initiation (R-HSA-73762)
  Regulation of PTEN gene transcription (R-HSA-8943724)
  Potential therapeutics for SARS (R-HSA-9679191)
  HDACs deacetylate histones (R-HSA-3214815)

Molecular Interaction Atlas (MIA) of This DOT

44 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Hyperglycemia	DIS0BZB5	Definitive	Biomarker	[1]
Matthew-Wood syndrome	DISA7HR7	Definitive	Altered Expression	[2]
Attention deficit hyperactivity disorder	DISL8MX9	Strong	Genetic Variation	[3]
Bipolar disorder	DISAM7J2	Strong	Genetic Variation	[4]
Bladder cancer	DISUHNM0	Strong	Biomarker	[5]
Brain neoplasm	DISY3EKS	Strong	Altered Expression	[6]
Breast cancer	DIS7DPX1	Strong	Biomarker	[7]
Breast carcinoma	DIS2UE88	Strong	Biomarker	[7]
Breast neoplasm	DISNGJLM	Strong	Altered Expression	[8]
Common variable immunodeficiency	DISHE7JQ	Strong	Biomarker	[9]
Endometriosis	DISX1AG8	Strong	Genetic Variation	[10]
Gastric cancer	DISXGOUK	Strong	Altered Expression	[11]
Glioma	DIS5RPEH	Strong	Altered Expression	[12]
Gonorrhea	DISQ5AO6	Strong	Biomarker	[13]
Hepatitis B virus infection	DISLQ2XY	Strong	Biomarker	[13]
Inflammatory bowel disease	DISGN23E	Strong	Genetic Variation	[14]
Lung cancer	DISCM4YA	Strong	Genetic Variation	[15]
Lung carcinoma	DISTR26C	Strong	Genetic Variation	[15]
Mental disorder	DIS3J5R8	Strong	Genetic Variation	[16]
Non-small-cell lung cancer	DIS5Y6R9	Strong	Altered Expression	[17]
Oral cancer	DISLD42D	Strong	Biomarker	[18]
Pancreatic ductal carcinoma	DIS26F9Q	Strong	Biomarker	[2]
Stomach cancer	DISKIJSX	Strong	Altered Expression	[11]
Systemic lupus erythematosus	DISI1SZ7	Strong	Biomarker	[19]
Trichomoniasis	DIS9HBNL	Strong	Biomarker	[13]
Urinary bladder cancer	DISDV4T7	Strong	Biomarker	[5]
Urinary bladder neoplasm	DIS7HACE	Strong	Biomarker	[5]
Clear cell renal carcinoma	DISBXRFJ	moderate	Biomarker	[20]
Hepatocellular carcinoma	DIS0J828	moderate	Biomarker	[21]
High blood pressure	DISY2OHH	moderate	Biomarker	[22]
Kidney cancer	DISBIPKM	moderate	Biomarker	[20]
Pelvic inflammatory disease	DISWQR4J	moderate	Genetic Variation	[23]
Plasma cell myeloma	DIS0DFZ0	moderate	Biomarker	[24]
Renal carcinoma	DISER9XT	moderate	Biomarker	[20]
Renal cell carcinoma	DISQZ2X8	moderate	Biomarker	[20]
Triple negative breast cancer	DISAMG6N	moderate	Biomarker	[7]
Carcinoma	DISH9F1N	Limited	Altered Expression	[25]
Cervical cancer	DISFSHPF	Limited	Genetic Variation	[26]
Cervical carcinoma	DIST4S00	Limited	Genetic Variation	[26]
Chronic obstructive pulmonary disease	DISQCIRF	Limited	Biomarker	[27]
Complement deficiency	DISGN469	Limited	Biomarker	[28]
Malignant pleural mesothelioma	DIST2R60	Limited	Altered Expression	[29]
Metastatic malignant neoplasm	DIS86UK6	Limited	Altered Expression	[25]
Pancreatic cancer	DISJC981	Limited	Altered Expression	[30]

13 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of Metastasis-associated protein MTA2 (MTA2).	[31]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of Metastasis-associated protein MTA2 (MTA2).	[32]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Metastasis-associated protein MTA2 (MTA2).	[33]
Vorinostat	DMWMPD4	Approved	Vorinostat decreases the expression of Metastasis-associated protein MTA2 (MTA2).	[34]
Menadione	DMSJDTY	Approved	Menadione affects the expression of Metastasis-associated protein MTA2 (MTA2).	[35]
Diethylstilbestrol	DMN3UXQ	Approved	Diethylstilbestrol increases the expression of Metastasis-associated protein MTA2 (MTA2).	[36]
Ibuprofen	DM8VCBE	Approved	Ibuprofen increases the expression of Metastasis-associated protein MTA2 (MTA2).	[37]
Rofecoxib	DM3P5DA	Approved	Rofecoxib decreases the expression of Metastasis-associated protein MTA2 (MTA2).	[37]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the expression of Metastasis-associated protein MTA2 (MTA2).	[38]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Metastasis-associated protein MTA2 (MTA2).	[39]
Leflunomide	DMR8ONJ	Phase 1 Trial	Leflunomide decreases the expression of Metastasis-associated protein MTA2 (MTA2).	[40]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Metastasis-associated protein MTA2 (MTA2).	[42]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A affects the expression of Metastasis-associated protein MTA2 (MTA2).	[43]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 affects the phosphorylation of Metastasis-associated protein MTA2 (MTA2).	[41]
Coumarin	DM0N8ZM	Investigative	Coumarin increases the phosphorylation of Metastasis-associated protein MTA2 (MTA2).	[41]

References

• [1] Model Free iPID Control for Glycemia Regulation of Type-1 Diabetes.IEEE Trans Biomed Eng. 2018 Jan;65(1):199-206. doi: 10.1109/TBME.2017.2698036. Epub 2017 Apr 25.
• [2] MTA2-mediated inhibition of PTEN leads to pancreatic ductal adenocarcinoma carcinogenicity.Cell Death Dis. 2019 Feb 27;10(3):206. doi: 10.1038/s41419-019-1424-5.
• [3] Latent Class Analysis of ADHD Neurodevelopmental and Mental Health Comorbidities.J Dev Behav Pediatr. 2018 Jan;39(1):10-19. doi: 10.1097/DBP.0000000000000508.
• [4] Differentiating bipolar disorder from borderline personality disorder: Diagnostic accuracy of the difficulty in emotion regulation scale and personality inventory for DSM-5.J Affect Disord. 2019 Feb 15;245:856-860. doi: 10.1016/j.jad.2018.11.079. Epub 2018 Nov 13.
• [5] Large-scale pathway-based analysis of bladder cancer genome-wide association data from five studies of European background.PLoS One. 2012;7(1):e29396. doi: 10.1371/journal.pone.0029396. Epub 2012 Jan 4.
• [6] Metastasis tumor-associated protein-2 knockdown suppresses the proliferation and invasion of human glioma cells in vitro and in vivo.J Neurooncol. 2014 Nov;120(2):273-81. doi: 10.1007/s11060-014-1558-3. Epub 2014 Jul 22.
• [7] MicroRNA-589 serves as a tumor suppressor microRNA through directly targeting metastasis-associated protein 2 in breast cancer.Oncol Lett. 2019 Sep;18(3):2232-2239. doi: 10.3892/ol.2019.10548. Epub 2019 Jun 28.
• [8] Metastasis-associated protein 2 is a repressor of estrogen receptor alpha whose overexpression leads to estrogen-independent growth of human breast cancer cells.Mol Endocrinol. 2006 Sep;20(9):2020-35. doi: 10.1210/me.2005-0063. Epub 2006 Apr 27.
• [9] Evaluating the Genetics of Common Variable Immunodeficiency: Monogenetic Model and Beyond.Front Immunol. 2018 May 14;9:636. doi: 10.3389/fimmu.2018.00636. eCollection 2018.
• [10] Genome-wide genetic analyses highlight mitogen-activated protein kinase (MAPK) signaling in the pathogenesis of endometriosis.Hum Reprod. 2017 Apr 1;32(4):780-793. doi: 10.1093/humrep/dex024.
• [11] Identification of candidate biomarkers that involved in the epigenetic transcriptional regulation for detection gastric cancer by iTRAQ based quantitative proteomic analysis.Clin Chim Acta. 2017 Aug;471:29-37. doi: 10.1016/j.cca.2017.05.015. Epub 2017 May 11.
• [12] miR-548b inhibits the proliferation and invasion of malignant gliomas by targeting metastasis tumor-associated protein-2.Neuroreport. 2016 Dec 7;27(17):1266-1273. doi: 10.1097/WNR.0000000000000690.
• [13] Video-based education versus nurse-led education for partner notification in Thai women with sexually transmitted infections: a randomized controlled trial.Int J STD AIDS. 2018 Nov;29(11):1076-1083. doi: 10.1177/0956462418775507. Epub 2018 May 22.
• [14] Is Whole Exome Sequencing Clinically Practical in the Management of Pediatric Crohn's Disease?.Gut Liver. 2015 Nov 23;9(6):767-75. doi: 10.5009/gnl15176.
• [15] Genome-wide DNA methylation and RNA expression profiles identified RIPK3 as a differentially methylated gene in Chlamydia pneumoniae infection lung carcinoma patients in China.Cancer Manag Res. 2019 Jun 28;11:5785-5797. doi: 10.2147/CMAR.S186217. eCollection 2019.
• [16] DSM-5 Personality Disorders and Traits in Patients With Severe Health Anxiety.J Nerv Ment Dis. 2020 Feb;208(2):108-117. doi: 10.1097/NMD.0000000000001108.
• [17] Metastasis-associated protein 2 promotes the metastasis of non-small cell lung carcinoma by regulating the ERK/AKT and VEGF signaling pathways.Mol Med Rep. 2018 Apr;17(4):4899-4908. doi: 10.3892/mmr.2018.8535. Epub 2018 Feb 1.
• [18] Repression of metastasis-associated protein 2 for inhibiting metastasis of human oral cancer cells by promoting the p-cofilin-1/ LC3-II expression.J Oral Pathol Med. 2019 Nov;48(10):959-966. doi: 10.1111/jop.12941. Epub 2019 Aug 18.
• [19] Inactivation of NuRD component Mta2 causes abnormal T cell activation and lupus-like autoimmune disease in mice.J Biol Chem. 2008 May 16;283(20):13825-33. doi: 10.1074/jbc.M801275200. Epub 2008 Mar 19.
• [20] MTA2 as a Potential Biomarker and Its Involvement in Metastatic Progression of Human Renal Cancer by miR-133b Targeting MMP-9.Cancers (Basel). 2019 Nov 23;11(12):1851. doi: 10.3390/cancers11121851.
• [21] Metastasis-associated protein 2 regulates human hepatocellular carcinoma metastasis progression through modulating p38MAPK/MMP2 pathways.J Cancer. 2019 Oct 22;10(26):6716-6725. doi: 10.7150/jca.35626. eCollection 2019.
• [22] Closed-loop regulation of arterial pressure after acute brain death.J Clin Monit Comput. 2018 Jun;32(3):429-437. doi: 10.1007/s10877-017-0033-z. Epub 2017 Jun 10.
• [23] Convergent and Discriminant Validity of Personality Inventory for DSM-5-BF in a Primary Care Sample.J Pers Disord. 2019 Dec;33(6):846-856. doi: 10.1521/pedi_2018_32_372. Epub 2018 Oct 24.
• [24] Constraints on signaling network logic reveal functional subgraphs on Multiple Myeloma OMIC data.BMC Syst Biol. 2018 Mar 21;12(Suppl 3):32. doi: 10.1186/s12918-018-0551-4.
• [25] Reciprocal loop of hypoxia-inducible factor-1 (HIF-1) and metastasis-associated protein 2 (MTA2) contributes to the progression of pancreatic carcinoma by suppressing E-cadherin transcription.J Pathol. 2018 Jul;245(3):349-360. doi: 10.1002/path.5089. Epub 2018 Jun 1.
• [26] Molecular analysis of cellular loci disrupted by papillomavirus 16 integration in cervical cancer: frequent viral integration in topologically destabilized and transcriptionally active chromosomal regions.J Med Virol. 1996 May;49(1):15-22. doi: 10.1002/(SICI)1096-9071(199605)49:1<15::AID-JMV3>3.0.CO;2-N.
• [27] Two Interventions for Patients with Major Depression and Severe Chronic Obstructive Pulmonary Disease: Impact on Dyspnea-Related Disability.Am J Geriatr Psychiatry. 2018 Feb;26(2):162-171. doi: 10.1016/j.jagp.2017.10.002. Epub 2017 Oct 10.
• [28] The Kuwait National Primary Immunodeficiency Registry 2004-2018.Front Immunol. 2019 Jul 24;10:1754. doi: 10.3389/fimmu.2019.01754. eCollection 2019.
• [29] Computational genomic analysis of PARK7 interactome reveals high BBS1 gene expression as a prognostic factor favoring survival in malignant pleural mesothelioma.Am J Physiol Lung Cell Mol Physiol. 2015 Oct 1;309(7):L677-86. doi: 10.1152/ajplung.00051.2015. Epub 2015 Aug 7.
• [30] LncRNA-MTA2TR functions as a promoter in pancreatic cancer via driving deacetylation-dependent accumulation of HIF-1.Theranostics. 2019 Jul 9;9(18):5298-5314. doi: 10.7150/thno.34559. eCollection 2019.
• [31] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [32] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [33] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [34] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [35] Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
• [36] Identification of biomarkers and outcomes of endocrine disruption in human ovarian cortex using In Vitro Models. Toxicology. 2023 Feb;485:153425. doi: 10.1016/j.tox.2023.153425. Epub 2023 Jan 5.
• [37] Rofecoxib modulates multiple gene expression pathways in a clinical model of acute inflammatory pain. Pain. 2007 Mar;128(1-2):136-47.
• [38] Identification of a transcriptomic signature of food-relevant genotoxins in human HepaRG hepatocarcinoma cells. Food Chem Toxicol. 2020 Jun;140:111297. doi: 10.1016/j.fct.2020.111297. Epub 2020 Mar 28.
• [39] BET bromodomain inhibition of MYC-amplified medulloblastoma. Clin Cancer Res. 2014 Feb 15;20(4):912-25.
• [40] Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
• [41] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [42] Environmental pollutant induced cellular injury is reflected in exosomes from placental explants. Placenta. 2020 Jan 1;89:42-49. doi: 10.1016/j.placenta.2019.10.008. Epub 2019 Oct 17.
• [43] A trichostatin A expression signature identified by TempO-Seq targeted whole transcriptome profiling. PLoS One. 2017 May 25;12(5):e0178302. doi: 10.1371/journal.pone.0178302. eCollection 2017.