Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTFM3TI9)

• DOT Name: Pachytene checkpoint protein 2 homolog (TRIP13)
• Synonyms: Human papillomavirus type 16 E1 protein-binding protein; 16E1-BP; HPV16 E1 protein-binding protein; Thyroid hormone receptor interactor 13; Thyroid receptor-interacting protein 13; TR-interacting protein 13; TRIP-13
• Gene Name: TRIP13
• Related Disease:
  Plasma cell myeloma
  Thyroid cancer
  Thyroid gland carcinoma
  Thyroid tumor
  Abdominal aortic aneurysm
  Adenocarcinoma
  Advanced cancer
  Aortic aneurysm
  Bartter syndrome
  Bladder cancer
  Breast cancer
  Breast carcinoma
  Childhood kidney Wilms tumor
  Chordoma
  Colorectal carcinoma
  Embryonal neoplasm
  Epithelial ovarian cancer
  Esophageal squamous cell carcinoma
  Germ cell tumor
  Head and neck cancer
  Head and neck carcinoma
  Head-neck squamous cell carcinoma
  Isolated congenital microcephaly
  Lung adenocarcinoma
  Mosaic variegated aneuploidy syndrome 1
  Mosaic variegated aneuploidy syndrome 3
  Neoplasm
  Oocyte maturation defect 9
  Pontocerebellar hypoplasia
  Pontocerebellar hypoplasia type 2
  Prostate cancer
  Prostate carcinoma
  Schizophrenia
  Urinary bladder cancer
  Urinary bladder neoplasm
  Wilms tumor
  Female infertility due to oocyte meiotic arrest
  Kidney Wilms tumor
  Mosaic variegated aneuploidy syndrome
  Hepatocellular carcinoma
  Lung cancer
  Lung carcinoma
  Melanoma
  Mycosis fungoides
  Small lymphocytic lymphoma
• UniProt ID: PCH2_HUMAN
• PDB ID: 5VQ9; 5VQA; 5WC2; 6F0X; 6LK0; 7L9P
• Pfam ID: PF00004
• Sequence:
  MDEAVGDLKQALPCVAESPTVHVEVHQRGSSTAKKEDINLSVRKLLNRHNIVFGDYTWTE
  FDEPFLTRNVQSVSIIDTELKVKDSQPIDLSACTVALHIFQLNEDGPSSENLEEETENII
  AANHWVLPAAEFHGLWDSLVYDVEVKSHLLDYVMTTLLFSDKNVNSNLITWNRVVLLHGP
  PGTGKTSLCKALAQKLTIRLSSRYRYGQLIEINSHSLFSKWFSESGKLVTKMFQKIQDLI
  DDKDALVFVLIDEVESLTAARNACRAGTEPSDAIRVVNAVLTQIDQIKRHSNVVILTTSN
  ITEKIDVAFVDRADIKQYIGPPSAAAIFKIYLSCLEELMKCQIIYPRQQLLTLRELEMIG
  FIENNVSKLSLLLNDISRKSEGLSGRVLRKLPFLAHALYVQAPTVTIEGFLQALSLAVDK
  QFEERKKLAAYI
• Function: Plays a key role in chromosome recombination and chromosome structure development during meiosis. Required at early steps in meiotic recombination that leads to non-crossovers pathways. Also needed for efficient completion of homologous synapsis by influencing crossover distribution along the chromosomes affecting both crossovers and non-crossovers pathways. Also required for development of higher-order chromosome structures and is needed for synaptonemal-complex formation. In males, required for efficient synapsis of the sex chromosomes and for sex body formation. Promotes early steps of the DNA double-strand breaks (DSBs) repair process upstream of the assembly of RAD51 complexes. Required for depletion of HORMAD1 and HORMAD2 from synapsed chromosomes. Plays a role in mitotic spindle assembly checkpoint (SAC) activation.
• KEGG Pathway: Cell cycle (hsa04110)

Molecular Interaction Atlas (MIA) of This DOT

45 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Plasma cell myeloma	DIS0DFZ0	Definitive	Biomarker	[1]
Thyroid cancer	DIS3VLDH	Definitive	Altered Expression	[2]
Thyroid gland carcinoma	DISMNGZ0	Definitive	Altered Expression	[2]
Thyroid tumor	DISLVKMD	Definitive	Altered Expression	[2]
Abdominal aortic aneurysm	DISD06OF	Strong	Biomarker	[3]
Adenocarcinoma	DIS3IHTY	Strong	Altered Expression	[4]
Advanced cancer	DISAT1Z9	Strong	Biomarker	[5]
Aortic aneurysm	DISQ5KRA	Strong	Biomarker	[3]
Bartter syndrome	DIS7D44B	Strong	Biomarker	[6]
Bladder cancer	DISUHNM0	Strong	Biomarker	[5]
Breast cancer	DIS7DPX1	Strong	Biomarker	[7]
Breast carcinoma	DIS2UE88	Strong	Altered Expression	[8]
Childhood kidney Wilms tumor	DIS0NMK3	Strong	Genetic Variation	[9]
Chordoma	DISCHJE7	Strong	Altered Expression	[10]
Colorectal carcinoma	DIS5PYL0	Strong	Biomarker	[11]
Embryonal neoplasm	DIS5MQSB	Strong	Biomarker	[12]
Epithelial ovarian cancer	DIS56MH2	Strong	Altered Expression	[13]
Esophageal squamous cell carcinoma	DIS5N2GV	Strong	Altered Expression	[14]
Germ cell tumor	DIS62070	Strong	Biomarker	[12]
Head and neck cancer	DISBPSQZ	Strong	Biomarker	[15]
Head and neck carcinoma	DISOU1DS	Strong	Biomarker	[15]
Head-neck squamous cell carcinoma	DISF7P24	Strong	Biomarker	[15]
Isolated congenital microcephaly	DISUXHZ6	Strong	Biomarker	[16]
Lung adenocarcinoma	DISD51WR	Strong	Biomarker	[17]
Mosaic variegated aneuploidy syndrome 1	DISOV0CG	Strong	GermlineCausalMutation	[12]
Mosaic variegated aneuploidy syndrome 3	DISXPRED	Strong	Autosomal recessive	[12]
Neoplasm	DISZKGEW	Strong	Altered Expression	[18]
Oocyte maturation defect 9	DIS5SP4S	Strong	Autosomal recessive	[19]
Pontocerebellar hypoplasia	DISRICMU	Strong	Genetic Variation	[20]
Pontocerebellar hypoplasia type 2	DISXV76G	Strong	Biomarker	[21]
Prostate cancer	DISF190Y	Strong	Biomarker	[22]
Prostate carcinoma	DISMJPLE	Strong	Biomarker	[22]
Schizophrenia	DISSRV2N	Strong	Biomarker	[23]
Urinary bladder cancer	DISDV4T7	Strong	Biomarker	[5]
Urinary bladder neoplasm	DIS7HACE	Strong	Biomarker	[5]
Wilms tumor	DISB6T16	Strong	Genetic Variation	[9]
Female infertility due to oocyte meiotic arrest	DISHCD3C	Moderate	Autosomal recessive	[24]
Kidney Wilms tumor	DIS7WJYB	Supportive	Autosomal dominant	[12]
Mosaic variegated aneuploidy syndrome	DIS5QTMU	Supportive	Autosomal dominant	[12]
Hepatocellular carcinoma	DIS0J828	Limited	Altered Expression	[18]
Lung cancer	DISCM4YA	Limited	Altered Expression	[25]
Lung carcinoma	DISTR26C	Limited	Altered Expression	[25]
Melanoma	DIS1RRCY	Limited	Biomarker	[26]
Mycosis fungoides	DIS62RB8	Limited	Biomarker	[27]
Small lymphocytic lymphoma	DIS30POX	Limited	Biomarker	[28]

This DOT Affected the Drug Response of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Cisplatin	DMRHGI9	Approved	Pachytene checkpoint protein 2 homolog (TRIP13) affects the response to substance of Cisplatin.	[53]

27 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Pachytene checkpoint protein 2 homolog (TRIP13).	[29]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Pachytene checkpoint protein 2 homolog (TRIP13).	[30]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Pachytene checkpoint protein 2 homolog (TRIP13).	[31]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Pachytene checkpoint protein 2 homolog (TRIP13).	[32]
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of Pachytene checkpoint protein 2 homolog (TRIP13).	[33]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Pachytene checkpoint protein 2 homolog (TRIP13).	[34]
Quercetin	DM3NC4M	Approved	Quercetin affects the expression of Pachytene checkpoint protein 2 homolog (TRIP13).	[35]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide increases the expression of Pachytene checkpoint protein 2 homolog (TRIP13).	[36]
Calcitriol	DM8ZVJ7	Approved	Calcitriol decreases the expression of Pachytene checkpoint protein 2 homolog (TRIP13).	[37]
Testosterone	DM7HUNW	Approved	Testosterone decreases the expression of Pachytene checkpoint protein 2 homolog (TRIP13).	[37]
Zoledronate	DMIXC7G	Approved	Zoledronate decreases the expression of Pachytene checkpoint protein 2 homolog (TRIP13).	[38]
Niclosamide	DMJAGXQ	Approved	Niclosamide decreases the expression of Pachytene checkpoint protein 2 homolog (TRIP13).	[39]
Troglitazone	DM3VFPD	Approved	Troglitazone decreases the expression of Pachytene checkpoint protein 2 homolog (TRIP13).	[40]
Azathioprine	DMMZSXQ	Approved	Azathioprine decreases the expression of Pachytene checkpoint protein 2 homolog (TRIP13).	[41]
Dasatinib	DMJV2EK	Approved	Dasatinib decreases the expression of Pachytene checkpoint protein 2 homolog (TRIP13).	[42]
Urethane	DM7NSI0	Phase 4	Urethane decreases the expression of Pachytene checkpoint protein 2 homolog (TRIP13).	[43]
Resveratrol	DM3RWXL	Phase 3	Resveratrol increases the expression of Pachytene checkpoint protein 2 homolog (TRIP13).	[44]
Genistein	DM0JETC	Phase 2/3	Genistein increases the expression of Pachytene checkpoint protein 2 homolog (TRIP13).	[33]
GSK2110183	DMZHB37	Phase 2	GSK2110183 decreases the expression of Pachytene checkpoint protein 2 homolog (TRIP13).	[45]
PEITC	DMOMN31	Phase 2	PEITC decreases the expression of Pachytene checkpoint protein 2 homolog (TRIP13).	[46]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the expression of Pachytene checkpoint protein 2 homolog (TRIP13).	[47]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Pachytene checkpoint protein 2 homolog (TRIP13).	[48]
Leflunomide	DMR8ONJ	Phase 1 Trial	Leflunomide decreases the expression of Pachytene checkpoint protein 2 homolog (TRIP13).	[49]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Pachytene checkpoint protein 2 homolog (TRIP13).	[50]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Pachytene checkpoint protein 2 homolog (TRIP13).	[51]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde decreases the expression of Pachytene checkpoint protein 2 homolog (TRIP13).	[52]
Coumestrol	DM40TBU	Investigative	Coumestrol increases the expression of Pachytene checkpoint protein 2 homolog (TRIP13).	[44]

References

• [1] A Small-Molecule Inhibitor Targeting TRIP13 Suppresses Multiple Myeloma Progression.Cancer Res. 2020 Feb 1;80(3):536-548. doi: 10.1158/0008-5472.CAN-18-3987. Epub 2019 Nov 15.
• [2] TRIP13 interference inhibits the proliferation and metastasis of thyroid cancer cells through regulating TTC5/p53 pathway and epithelial-mesenchymal transition related genes expression.Biomed Pharmacother. 2019 Dec;120:109508. doi: 10.1016/j.biopha.2019.109508. Epub 2019 Oct 22.
• [3] Characterization of Pch2 localization determinants reveals a nucleolar-independent role in the meiotic recombination checkpoint.Chromosoma. 2019 Sep;128(3):297-316. doi: 10.1007/s00412-019-00696-7. Epub 2019 Mar 12.
• [4] Prognostic Value of BIRC5 in Lung Adenocarcinoma Lacking EGFR, KRAS, and ALK Mutations by Integrated Bioinformatics Analysis.Dis Markers. 2019 Apr 9;2019:5451290. doi: 10.1155/2019/5451290. eCollection 2019.
• [5] Four novel biomarkers for bladder cancer identified by weighted gene coexpression network analysis.J Cell Physiol. 2019 Aug;234(10):19073-19087. doi: 10.1002/jcp.28546. Epub 2019 Mar 29.
• [6] Pontocerebellar hypoplasia: clinical, pathologic, and genetic studies.Neurology. 2010 Oct 19;75(16):1459-64. doi: 10.1212/WNL.0b013e3181f88173.
• [7] DNA-damage related genes and clinical outcome in hormone receptor positive breast cancer.Oncotarget. 2016 Jul 28;8(38):62834-62841. doi: 10.18632/oncotarget.10886. eCollection 2017 Sep 8.
• [8] Translating Proteomic Into Functional Data: An High Mobility Group A1 (HMGA1) Proteomic Signature Has Prognostic Value in Breast Cancer.Mol Cell Proteomics. 2016 Jan;15(1):109-23. doi: 10.1074/mcp.M115.050401. Epub 2015 Nov 2.
• [9] Absence of the TRIP13 c.1060C>T Mutation in Wilms Tumor Patients From Pakistan.J Pediatr Hematol Oncol. 2020 Apr;42(3):e128-e131. doi: 10.1097/MPH.0000000000001602.
• [10] The embryonic transcription factor Brachyury confers chordoma chemoresistance via upregulating CA9.Am J Transl Res. 2018 Mar 15;10(3):936-947. eCollection 2018.
• [11] TRIP13 promotes tumor growth and is associated with poor prognosis in colorectal cancer.Cell Death Dis. 2018 Mar 14;9(3):402. doi: 10.1038/s41419-018-0434-z.
• [12] Biallelic TRIP13 mutations predispose to Wilms tumor and chromosome missegregation. Nat Genet. 2017 Jul;49(7):1148-1151. doi: 10.1038/ng.3883. Epub 2017 May 29.
• [13] TRIP13 promotes proliferation and invasion of epithelial ovarian cancer cells through Notch signaling pathway.Eur Rev Med Pharmacol Sci. 2019 Jan;23(2):522-529. doi: 10.26355/eurrev_201901_16864.
• [14] TRIP13 upregulation is correlated with poor prognosis and tumor progression in esophageal squamous cell carcinoma.Pathol Res Pract. 2019 Jun;215(6):152415. doi: 10.1016/j.prp.2019.04.007. Epub 2019 Apr 17.
• [15] TRIP13 promotes error-prone nonhomologous end joining and induces chemoresistance in head and neck cancer.Nat Commun. 2014 Jul 31;5:4527. doi: 10.1038/ncomms5527.
• [16] Pontocerebellar hypoplasia type 2 and TSEN2: review of the literature and two novel mutations. Eur J Med Genet. 2013 Jun;56(6):325-30. doi: 10.1016/j.ejmg.2013.03.009. Epub 2013 Apr 3.
• [17] Thyroid hormone receptor interactor 13 (TRIP13) overexpression associated with tumor progression and poor prognosis in lung adenocarcinoma.Biochem Biophys Res Commun. 2018 May 15;499(3):416-424. doi: 10.1016/j.bbrc.2018.03.129. Epub 2018 Mar 30.
• [18] Multiple novel hepatocellular carcinoma signature genes are commonly controlled by the master pluripotency factor OCT4.Cell Oncol (Dordr). 2020 Apr;43(2):279-295. doi: 10.1007/s13402-019-00487-3. Epub 2019 Dec 17.
• [19] Bi-allelic Missense Pathogenic Variants in TRIP13 Cause Female Infertility Characterized by Oocyte Maturation Arrest. Am J Hum Genet. 2020 Jul 2;107(1):15-23. doi: 10.1016/j.ajhg.2020.05.001. Epub 2020 May 29.
• [20] Autosomal-Recessive Mutations in the tRNA Splicing Endonuclease Subunit TSEN15 Cause Pontocerebellar Hypoplasia and Progressive Microcephaly. Am J Hum Genet. 2016 Jul 7;99(1):228-35. doi: 10.1016/j.ajhg.2016.05.023.
• [21] Molecular and neuroimaging findings in pontocerebellar hypoplasia type 2 (PCH2): is prenatal diagnosis possible?.Am J Med Genet A. 2010 Sep;152A(9):2268-76. doi: 10.1002/ajmg.a.33579.
• [22] TRIP13 is a predictor for poor prognosis and regulates cell proliferation, migration and invasion in prostate cancer.Int J Biol Macromol. 2019 Jan;121:200-206. doi: 10.1016/j.ijbiomac.2018.09.168. Epub 2018 Sep 26.
• [23] Principal components of heritability from neurocognitive domains differ between families with schizophrenia and control subjects.Schizophr Bull. 2013 Mar;39(2):464-71. doi: 10.1093/schbul/sbr161. Epub 2012 Jan 10.
• [24] Technical standards for the interpretation and reporting of constitutional copy-number variants: a joint consensus recommendation of the American College of Medical Genetics and Genomics (ACMG) and the Clinical Genome Resource (ClinGen). Genet Med. 2020 Feb;22(2):245-257. doi: 10.1038/s41436-019-0686-8. Epub 2019 Nov 6.
• [25] Elevated expression of thyroid hormone receptor-interacting protein 13 drives tumorigenesis and affects clinical outcome.Biomark Med. 2017 Jan;11(1):19-31. doi: 10.2217/bmm-2016-0169. Epub 2016 Nov 9.
• [26] Systematic Analysis of Gene Expression Alterations and Clinical Outcomes for Long-Chain Acyl-Coenzyme A Synthetase Family in Cancer.PLoS One. 2016 May 12;11(5):e0155660. doi: 10.1371/journal.pone.0155660. eCollection 2016.
• [27] A meta-analysis of gene expression data identifies a molecular signature characteristic for tumor-stage mycosis fungoides.J Invest Dermatol. 2012 Aug;132(8):2050-9. doi: 10.1038/jid.2012.117. Epub 2012 Apr 19.
• [28] Loss of thyroid hormone receptor interactor 13 inhibits cell proliferation and survival in human chronic lymphocytic leukemia.Oncotarget. 2017 Apr 11;8(15):25469-25481. doi: 10.18632/oncotarget.16038.
• [29] The neuroprotective action of the mood stabilizing drugs lithium chloride and sodium valproate is mediated through the up-regulation of the homeodomain protein Six1. Toxicol Appl Pharmacol. 2009 Feb 15;235(1):124-34.
• [30] Inter-laboratory comparison of human renal proximal tubule (HK-2) transcriptome alterations due to Cyclosporine A exposure and medium exhaustion. Toxicol In Vitro. 2009 Apr;23(3):486-99.
• [31] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [32] Predictive toxicology using systemic biology and liver microfluidic "on chip" approaches: application to acetaminophen injury. Toxicol Appl Pharmacol. 2012 Mar 15;259(3):270-80.
• [33] Convergent transcriptional profiles induced by endogenous estrogen and distinct xenoestrogens in breast cancer cells. Carcinogenesis. 2006 Aug;27(8):1567-78.
• [34] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [35] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [36] Classification of heavy-metal toxicity by human DNA microarray analysis. Environ Sci Technol. 2007 May 15;41(10):3769-74.
• [37] Effects of 1alpha,25 dihydroxyvitamin D3 and testosterone on miRNA and mRNA expression in LNCaP cells. Mol Cancer. 2011 May 18;10:58.
• [38] Interleukin-19 as a translational indicator of renal injury. Arch Toxicol. 2015 Jan;89(1):101-6.
• [39] Computational discovery of niclosamide ethanolamine, a repurposed drug candidate that reduces growth of hepatocellular carcinoma cells initro and in mice by inhibiting cell division cycle 37 signaling. Gastroenterology. 2017 Jun;152(8):2022-2036.
• [40] Effects of ciglitazone and troglitazone on the proliferation of human stomach cancer cells. World J Gastroenterol. 2009 Jan 21;15(3):310-20.
• [41] A transcriptomics-based in vitro assay for predicting chemical genotoxicity in vivo. Carcinogenesis. 2012 Jul;33(7):1421-9.
• [42] Dasatinib reverses cancer-associated fibroblasts (CAFs) from primary lung carcinomas to a phenotype comparable to that of normal fibroblasts. Mol Cancer. 2010 Jun 27;9:168.
• [43] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [44] Pleiotropic combinatorial transcriptomes of human breast cancer cells exposed to mixtures of dietary phytoestrogens. Food Chem Toxicol. 2009 Apr;47(4):787-95.
• [45] Novel ATP-competitive Akt inhibitor afuresertib suppresses the proliferation of malignant pleural mesothelioma cells. Cancer Med. 2017 Nov;6(11):2646-2659. doi: 10.1002/cam4.1179. Epub 2017 Sep 27.
• [46] Phenethyl isothiocyanate alters the gene expression and the levels of protein associated with cell cycle regulation in human glioblastoma GBM 8401 cells. Environ Toxicol. 2017 Jan;32(1):176-187.
• [47] Identification of a transcriptomic signature of food-relevant genotoxins in human HepaRG hepatocarcinoma cells. Food Chem Toxicol. 2020 Jun;140:111297. doi: 10.1016/j.fct.2020.111297. Epub 2020 Mar 28.
• [48] Inhibition of BRD4 attenuates tumor cell self-renewal and suppresses stem cell signaling in MYC driven medulloblastoma. Oncotarget. 2014 May 15;5(9):2355-71.
• [49] Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
• [50] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [51] Bisphenol A induces DSB-ATM-p53 signaling leading to cell cycle arrest, senescence, autophagy, stress response, and estrogen release in human fetal lung fibroblasts. Arch Toxicol. 2018 Apr;92(4):1453-1469.
• [52] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
• [53] Gene expression profiling of 30 cancer cell lines predicts resistance towards 11 anticancer drugs at clinically achieved concentrations. Int J Cancer. 2006 Apr 1;118(7):1699-712. doi: 10.1002/ijc.21570.