Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTHH8KU7)

DOT Name Serine/threonine-protein kinase mTOR (MTOR)
Synonyms
EC 2.7.11.1; FK506-binding protein 12-rapamycin complex-associated protein 1; FKBP12-rapamycin complex-associated protein; Mammalian target of rapamycin; mTOR; Mechanistic target of rapamycin; Rapamycin and FKBP12 target 1; Rapamycin target protein 1
Gene Name MTOR
Related Disease
Macrocephaly-intellectual disability-neurodevelopmental disorder-small thorax syndrome ( )
Overgrowth syndrome and/or cerebral malformations due to abnormalities in MTOR pathway genes ( )
UniProt ID
MTOR_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
1AUE ; 1FAP ; 1NSG ; 2FAP ; 2GAQ ; 2NPU ; 2RSE ; 3FAP ; 3JBZ ; 4DRH ; 4DRI ; 4DRJ ; 4FAP ; 4JSN ; 4JSP ; 4JSV ; 4JSX ; 4JT5 ; 4JT6 ; 5FLC ; 5GPG ; 5H64 ; 5WBH ; 5WBU ; 5WBY ; 5ZCS ; 6BCU ; 6BCX ; 6M4U ; 6M4W ; 6SB0 ; 6SB2 ; 6ZWM ; 6ZWO ; 7EPD ; 7OWG ; 7PE7 ; 7PE8 ; 7PE9 ; 7PEA ; 7PEB ; 7PEC ; 7TZO ; 7UXC ; 7UXH ; 8ER6 ; 8ER7 ; 8ERA ; 8PPZ
EC Number
2.7.11.1
Pfam ID
PF11865 ; PF02259 ; PF02260 ; PF08771 ; PF00454
Sequence
MLGTGPAAATTAATTSSNVSVLQQFASGLKSRNEETRAKAAKELQHYVTMELREMSQEES
TRFYDQLNHHIFELVSSSDANERKGGILAIASLIGVEGGNATRIGRFANYLRNLLPSNDP
VVMEMASKAIGRLAMAGDTFTAEYVEFEVKRALEWLGADRNEGRRHAAVLVLRELAISVP
TFFFQQVQPFFDNIFVAVWDPKQAIREGAVAALRACLILTTQREPKEMQKPQWYRHTFEE
AEKGFDETLAKEKGMNRDDRIHGALLILNELVRISSMEGERLREEMEEITQQQLVHDKYC
KDLMGFGTKPRHITPFTSFQAVQPQQSNALVGLLGYSSHQGLMGFGTSPSPAKSTLVESR
CCRDLMEEKFDQVCQWVLKCRNSKNSLIQMTILNLLPRLAAFRPSAFTDTQYLQDTMNHV
LSCVKKEKERTAAFQALGLLSVAVRSEFKVYLPRVLDIIRAALPPKDFAHKRQKAMQVDA
TVFTCISMLARAMGPGIQQDIKELLEPMLAVGLSPALTAVLYDLSRQIPQLKKDIQDGLL
KMLSLVLMHKPLRHPGMPKGLAHQLASPGLTTLPEASDVGSITLALRTLGSFEFEGHSLT
QFVRHCADHFLNSEHKEIRMEAARTCSRLLTPSIHLISGHAHVVSQTAVQVVADVLSKLL
VVGITDPDPDIRYCVLASLDERFDAHLAQAENLQALFVALNDQVFEIRELAICTVGRLSS
MNPAFVMPFLRKMLIQILTELEHSGIGRIKEQSARMLGHLVSNAPRLIRPYMEPILKALI
LKLKDPDPDPNPGVINNVLATIGELAQVSGLEMRKWVDELFIIIMDMLQDSSLLAKRQVA
LWTLGQLVASTGYVVEPYRKYPTLLEVLLNFLKTEQNQGTRREAIRVLGLLGALDPYKHK
VNIGMIDQSRDASAVSLSESKSSQDSSDYSTSEMLVNMGNLPLDEFYPAVSMVALMRIFR
DQSLSHHHTMVVQAITFIFKSLGLKCVQFLPQVMPTFLNVIRVCDGAIREFLFQQLGMLV
SFVKSHIRPYMDEIVTLMREFWVMNTSIQSTIILLIEQIVVALGGEFKLYLPQLIPHMLR
VFMHDNSPGRIVSIKLLAAIQLFGANLDDYLHLLLPPIVKLFDAPEAPLPSRKAALETVD
RLTESLDFTDYASRIIHPIVRTLDQSPELRSTAMDTLSSLVFQLGKKYQIFIPMVNKVLV
RHRINHQRYDVLICRIVKGYTLADEEEDPLIYQHRMLRSGQGDALASGPVETGPMKKLHV
STINLQKAWGAARRVSKDDWLEWLRRLSLELLKDSSSPSLRSCWALAQAYNPMARDLFNA
AFVSCWSELNEDQQDELIRSIELALTSQDIAEVTQTLLNLAEFMEHSDKGPLPLRDDNGI
VLLGERAAKCRAYAKALHYKELEFQKGPTPAILESLISINNKLQQPEAAAGVLEYAMKHF
GELEIQATWYEKLHEWEDALVAYDKKMDTNKDDPELMLGRMRCLEALGEWGQLHQQCCEK
WTLVNDETQAKMARMAAAAAWGLGQWDSMEEYTCMIPRDTHDGAFYRAVLALHQDLFSLA
QQCIDKARDLLDAELTAMAGESYSRAYGAMVSCHMLSELEEVIQYKLVPERREIIRQIWW
ERLQGCQRIVEDWQKILMVRSLVVSPHEDMRTWLKYASLCGKSGRLALAHKTLVLLLGVD
PSRQLDHPLPTVHPQVTYAYMKNMWKSARKIDAFQHMQHFVQTMQQQAQHAIATEDQQHK
QELHKLMARCFLKLGEWQLNLQGINESTIPKVLQYYSAATEHDRSWYKAWHAWAVMNFEA
VLHYKHQNQARDEKKKLRHASGANITNATTAATTAATATTTASTEGSNSESEAESTENSP
TPSPLQKKVTEDLSKTLLMYTVPAVQGFFRSISLSRGNNLQDTLRVLTLWFDYGHWPDVN
EALVEGVKAIQIDTWLQVIPQLIARIDTPRPLVGRLIHQLLTDIGRYHPQALIYPLTVAS
KSTTTARHNAANKILKNMCEHSNTLVQQAMMVSEELIRVAILWHEMWHEGLEEASRLYFG
ERNVKGMFEVLEPLHAMMERGPQTLKETSFNQAYGRDLMEAQEWCRKYMKSGNVKDLTQA
WDLYYHVFRRISKQLPQLTSLELQYVSPKLLMCRDLELAVPGTYDPNQPIIRIQSIAPSL
QVITSKQRPRKLTLMGSNGHEFVFLLKGHEDLRQDERVMQLFGLVNTLLANDPTSLRKNL
SIQRYAVIPLSTNSGLIGWVPHCDTLHALIRDYREKKKILLNIEHRIMLRMAPDYDHLTL
MQKVEVFEHAVNNTAGDDLAKLLWLKSPSSEVWFDRRTNYTRSLAVMSMVGYILGLGDRH
PSNLMLDRLSGKILHIDFGDCFEVAMTREKFPEKIPFRLTRMLTNAMEVTGLDGNYRITC
HTVMEVLREHKDSVMAVLEAFVYDPLLNWRLMDTNTKGNKRSRTRTDSYSAGQSVEILDG
VELGEPAHKKTGTTVPESIHSFIGDGLVKPEALNKKAIQIINRVRDKLTGRDFSHDDTLD
VPTQVELLIKQATSHENLCQCYIGWCPFW
Function
Serine/threonine protein kinase which is a central regulator of cellular metabolism, growth and survival in response to hormones, growth factors, nutrients, energy and stress signals. MTOR directly or indirectly regulates the phosphorylation of at least 800 proteins. Functions as part of 2 structurally and functionally distinct signaling complexes mTORC1 and mTORC2 (mTOR complex 1 and 2). In response to nutrients, growth factors or amino acids, mTORC1 is recruited to the lysosome membrane and promotes protein, lipid and nucleotide synthesis by phosphorylating key regulators of mRNA translation and ribosome synthesis. This includes phosphorylation of EIF4EBP1 and release of its inhibition toward the elongation initiation factor 4E (eiF4E). Moreover, phosphorylates and activates RPS6KB1 and RPS6KB2 that promote protein synthesis by modulating the activity of their downstream targets including ribosomal protein S6, eukaryotic translation initiation factor EIF4B, and the inhibitor of translation initiation PDCD4. Stimulates the pyrimidine biosynthesis pathway, both by acute regulation through RPS6KB1-mediated phosphorylation of the biosynthetic enzyme CAD, and delayed regulation, through transcriptional enhancement of the pentose phosphate pathway which produces 5-phosphoribosyl-1-pyrophosphate (PRPP), an allosteric activator of CAD at a later step in synthesis, this function is dependent on the mTORC1 complex. Regulates ribosome synthesis by activating RNA polymerase III-dependent transcription through phosphorylation and inhibition of MAF1 an RNA polymerase III-repressor. Activates dormant ribosomes by mediating phosphorylation of SERBP1, leading to SERBP1 inactivation and reactivation of translation. In parallel to protein synthesis, also regulates lipid synthesis through SREBF1/SREBP1 and LPIN1. To maintain energy homeostasis mTORC1 may also regulate mitochondrial biogenesis through regulation of PPARGC1A. In the same time, mTORC1 inhibits catabolic pathways: negatively regulates autophagy through phosphorylation of ULK1. Under nutrient sufficiency, phosphorylates ULK1 at 'Ser-758', disrupting the interaction with AMPK and preventing activation of ULK1. Also prevents autophagy through phosphorylation of the autophagy inhibitor DAP. Also prevents autophagy by phosphorylating RUBCNL/Pacer under nutrient-rich conditions. Prevents autophagy by mediating phosphorylation of AMBRA1, thereby inhibiting AMBRA1 ability to mediate ubiquitination of ULK1 and interaction between AMBRA1 and PPP2CA. mTORC1 exerts a feedback control on upstream growth factor signaling that includes phosphorylation and activation of GRB10 a INSR-dependent signaling suppressor. Among other potential targets mTORC1 may phosphorylate CLIP1 and regulate microtubules. The mTORC1 complex is inhibited in response to starvation and amino acid depletion. The non-canonical mTORC1 complex, which acts independently of RHEB, specifically mediates phosphorylation of MiT/TFE factors MITF, TFEB and TFE3 in the presence of nutrients, promoting their cytosolic retention and inactivation. Upon starvation or lysosomal stress, inhibition of mTORC1 induces dephosphorylation and nuclear translocation of TFEB and TFE3, promoting their transcription factor activity. The mTORC1 complex regulates pyroptosis in macrophages by promoting GSDMD oligomerization. MTOR phosphorylates RPTOR which in turn inhibits mTORC1. As part of the mTORC2 complex MTOR may regulate other cellular processes including survival and organization of the cytoskeleton. mTORC2 plays a critical role in the phosphorylation at 'Ser-473' of AKT1, a pro-survival effector of phosphoinositide 3-kinase, facilitating its activation by PDK1. mTORC2 may regulate the actin cytoskeleton, through phosphorylation of PRKCA, PXN and activation of the Rho-type guanine nucleotide exchange factors RHOA and RAC1A or RAC1B. mTORC2 also regulates the phosphorylation of SGK1 at 'Ser-422'. Regulates osteoclastogenesis by adjusting the expression of CEBPB isoforms. Plays an important regulatory role in the circadian clock function; regulates period length and rhythm amplitude of the suprachiasmatic nucleus (SCN) and liver clocks.
Tissue Specificity Expressed in numerous tissues, with highest levels in testis.
KEGG Pathway
EGFR tyrosine ki.se inhibitor resistance (hsa01521 )
Endocrine resistance (hsa01522 )
ErbB sig.ling pathway (hsa04012 )
HIF-1 sig.ling pathway (hsa04066 )
Phospholipase D sig.ling pathway (hsa04072 )
Autophagy - other (hsa04136 )
Autophagy - animal (hsa04140 )
mTOR sig.ling pathway (hsa04150 )
PI3K-Akt sig.ling pathway (hsa04151 )
AMPK sig.ling pathway (hsa04152 )
Longevity regulating pathway (hsa04211 )
Longevity regulating pathway - multiple species (hsa04213 )
Cellular senescence (hsa04218 )
Apelin sig.ling pathway (hsa04371 )
Neutrophil extracellular trap formation (hsa04613 )
JAK-STAT sig.ling pathway (hsa04630 )
Th17 cell differentiation (hsa04659 )
Thermogenesis (hsa04714 )
Insulin sig.ling pathway (hsa04910 )
Thyroid hormone sig.ling pathway (hsa04919 )
Adipocytokine sig.ling pathway (hsa04920 )
Type II diabetes mellitus (hsa04930 )
Insulin resistance (hsa04931 )
Growth hormone synthesis, secretion and action (hsa04935 )
Alzheimer disease (hsa05010 )
Amyotrophic lateral sclerosis (hsa05014 )
Huntington disease (hsa05016 )
Spinocerebellar ataxia (hsa05017 )
Pathways of neurodegeneration - multiple diseases (hsa05022 )
Shigellosis (hsa05131 )
Human cytomegalovirus infection (hsa05163 )
Human papillomavirus infection (hsa05165 )
Kaposi sarcoma-associated herpesvirus infection (hsa05167 )
Herpes simplex virus 1 infection (hsa05168 )
Human immunodeficiency virus 1 infection (hsa05170 )
Pathways in cancer (hsa05200 )
Proteoglycans in cancer (hsa05205 )
MicroR.s in cancer (hsa05206 )
Chemical carcinogenesis - receptor activation (hsa05207 )
Colorectal cancer (hsa05210 )
Pancreatic cancer (hsa05212 )
Glioma (hsa05214 )
Prostate cancer (hsa05215 )
Acute myeloid leukemia (hsa05221 )
Breast cancer (hsa05224 )
Hepatocellular carcinoma (hsa05225 )
Gastric cancer (hsa05226 )
Central carbon metabolism in cancer (hsa05230 )
Choline metabolism in cancer (hsa05231 )
PD-L1 expression and PD-1 checkpoint pathway in cancer (hsa05235 )
Diabetic cardiomyopathy (hsa05415 )
Reactome Pathway
Macroautophagy (R-HSA-1632852 )
MTOR signalling (R-HSA-165159 )
mTORC1-mediated signalling (R-HSA-166208 )
HSF1-dependent transactivation (R-HSA-3371571 )
Energy dependent regulation of mTOR by LKB1-AMPK (R-HSA-380972 )
CD28 dependent PI3K/Akt signaling (R-HSA-389357 )
VEGFR2 mediated vascular permeability (R-HSA-5218920 )
TP53 Regulates Metabolic Genes (R-HSA-5628897 )
Constitutive Signaling by AKT1 E17K in Cancer (R-HSA-5674400 )
Regulation of TP53 Degradation (R-HSA-6804757 )
Regulation of PTEN gene transcription (R-HSA-8943724 )
Amino acids regulate mTORC1 (R-HSA-9639288 )
PIP3 activates AKT signaling (R-HSA-1257604 )

Molecular Interaction Atlas (MIA) of This DOT

2 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Macrocephaly-intellectual disability-neurodevelopmental disorder-small thorax syndrome DISRFD82 Definitive Autosomal dominant [1]
Overgrowth syndrome and/or cerebral malformations due to abnormalities in MTOR pathway genes DISWECW7 Definitive Autosomal dominant [2]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
This DOT Affected the Drug Response of 4 Drug(s)
Drug Name Drug ID Highest Status Interaction REF
Fulvestrant DM0YZC6 Approved Serine/threonine-protein kinase mTOR (MTOR) decreases the response to substance of Fulvestrant. [88]
Trabectedin DMG3Y89 Approved Serine/threonine-protein kinase mTOR (MTOR) decreases the response to substance of Trabectedin. [89]
ABT-263 DMNE56X Phase 3 Serine/threonine-protein kinase mTOR (MTOR) affects the response to substance of ABT-263. [90]
Afimoxifene DMFORDT Phase 2 Serine/threonine-protein kinase mTOR (MTOR) decreases the response to substance of Afimoxifene. [88]
------------------------------------------------------------------------------------
46 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the expression of Serine/threonine-protein kinase mTOR (MTOR). [3]
Acetaminophen DMUIE76 Approved Acetaminophen decreases the expression of Serine/threonine-protein kinase mTOR (MTOR). [4]
Doxorubicin DMVP5YE Approved Doxorubicin decreases the expression of Serine/threonine-protein kinase mTOR (MTOR). [5]
Cisplatin DMRHGI9 Approved Cisplatin decreases the expression of Serine/threonine-protein kinase mTOR (MTOR). [6]
Estradiol DMUNTE3 Approved Estradiol decreases the expression of Serine/threonine-protein kinase mTOR (MTOR). [3]
Ivermectin DMDBX5F Approved Ivermectin decreases the expression of Serine/threonine-protein kinase mTOR (MTOR). [7]
Arsenic DMTL2Y1 Approved Arsenic increases the expression of Serine/threonine-protein kinase mTOR (MTOR). [8]
Arsenic trioxide DM61TA4 Approved Arsenic trioxide increases the expression of Serine/threonine-protein kinase mTOR (MTOR). [11]
Vorinostat DMWMPD4 Approved Vorinostat decreases the expression of Serine/threonine-protein kinase mTOR (MTOR). [13]
Progesterone DMUY35B Approved Progesterone decreases the expression of Serine/threonine-protein kinase mTOR (MTOR). [14]
Fluorouracil DMUM7HZ Approved Fluorouracil decreases the expression of Serine/threonine-protein kinase mTOR (MTOR). [3]
Niclosamide DMJAGXQ Approved Niclosamide increases the expression of Serine/threonine-protein kinase mTOR (MTOR). [15]
Cannabidiol DM0659E Approved Cannabidiol increases the expression of Serine/threonine-protein kinase mTOR (MTOR). [16]
Diethylstilbestrol DMN3UXQ Approved Diethylstilbestrol decreases the expression of Serine/threonine-protein kinase mTOR (MTOR). [3]
Ethanol DMDRQZU Approved Ethanol decreases the expression of Serine/threonine-protein kinase mTOR (MTOR). [19]
Colchicine DM2POTE Approved Colchicine decreases the expression of Serine/threonine-protein kinase mTOR (MTOR). [3]
Hydroxyurea DMOQVU9 Approved Hydroxyurea decreases the expression of Serine/threonine-protein kinase mTOR (MTOR). [3]
Sorafenib DMS8IFC Approved Sorafenib decreases the expression of Serine/threonine-protein kinase mTOR (MTOR). [27]
Imatinib DM7RJXL Approved Imatinib decreases the expression of Serine/threonine-protein kinase mTOR (MTOR). [30]
Cholecalciferol DMGU74E Approved Cholecalciferol decreases the expression of Serine/threonine-protein kinase mTOR (MTOR). [32]
Melatonin DMKWFBT Approved Melatonin increases the activity of Serine/threonine-protein kinase mTOR (MTOR). [25]
Gabapentin DM6T924 Approved Gabapentin decreases the expression of Serine/threonine-protein kinase mTOR (MTOR). [3]
Sulfadiazine DMTW3R8 Approved Sulfadiazine decreases the expression of Serine/threonine-protein kinase mTOR (MTOR). [3]
Cepharanthine DM9Y5JB Approved Cepharanthine decreases the expression of Serine/threonine-protein kinase mTOR (MTOR). [43]
Resveratrol DM3RWXL Phase 3 Resveratrol increases the expression of Serine/threonine-protein kinase mTOR (MTOR). [45]
Curcumin DMQPH29 Phase 3 Curcumin decreases the expression of Serine/threonine-protein kinase mTOR (MTOR). [27]
Camptothecin DM6CHNJ Phase 3 Camptothecin decreases the expression of Serine/threonine-protein kinase mTOR (MTOR). [43]
Psoralen DMIZJ8M Phase 3 Psoralen decreases the expression of Serine/threonine-protein kinase mTOR (MTOR). [50]
Rebamipide DM2GHCR Phase 3 Rebamipide increases the expression of Serine/threonine-protein kinase mTOR (MTOR). [51]
GDC0941 DM1YAK6 Phase 2 GDC0941 decreases the activity of Serine/threonine-protein kinase mTOR (MTOR). [56]
Beta-caryophyllene DM7583A Phase 2 Beta-caryophyllene decreases the expression of Serine/threonine-protein kinase mTOR (MTOR). [58]
Fucoxanthin DMPQFTA Phase 2 Fucoxanthin decreases the expression of Serine/threonine-protein kinase mTOR (MTOR). [60]
LY294002 DMY1AFS Phase 1 LY294002 decreases the expression of Serine/threonine-protein kinase mTOR (MTOR). [65]
Tetrandrine DMAOJBX Phase 1 Tetrandrine decreases the expression of Serine/threonine-protein kinase mTOR (MTOR). [43]
PMID28870136-Compound-52 DMFDERP Patented PMID28870136-Compound-52 decreases the activity of Serine/threonine-protein kinase mTOR (MTOR). [68]
MG-132 DMKA2YS Preclinical MG-132 increases the expression of Serine/threonine-protein kinase mTOR (MTOR). [70]
Dioscin DM5H2W9 Preclinical Dioscin decreases the expression of Serine/threonine-protein kinase mTOR (MTOR). [71]
Pifithrin-alpha DM63OD7 Terminated Pifithrin-alpha increases the expression of Serine/threonine-protein kinase mTOR (MTOR). [65]
Deguelin DMXT7WG Investigative Deguelin decreases the expression of Serine/threonine-protein kinase mTOR (MTOR). [77]
3R14S-OCHRATOXIN A DM2KEW6 Investigative 3R14S-OCHRATOXIN A decreases the expression of Serine/threonine-protein kinase mTOR (MTOR). [3]
Glyphosate DM0AFY7 Investigative Glyphosate decreases the expression of Serine/threonine-protein kinase mTOR (MTOR). [79]
Hexadecanoic acid DMWUXDZ Investigative Hexadecanoic acid increases the activity of Serine/threonine-protein kinase mTOR (MTOR). [80]
geraniol DMS3CBD Investigative geraniol decreases the activity of Serine/threonine-protein kinase mTOR (MTOR). [82]
4-hydroxy-2-nonenal DM2LJFZ Investigative 4-hydroxy-2-nonenal decreases the expression of Serine/threonine-protein kinase mTOR (MTOR). [83]
Lithium chloride DMHYLQ2 Investigative Lithium chloride decreases the expression of Serine/threonine-protein kinase mTOR (MTOR). [3]
Rapamycin Immunosuppressant Drug DM678IB Investigative Rapamycin Immunosuppressant Drug decreases the expression of Serine/threonine-protein kinase mTOR (MTOR). [86]
------------------------------------------------------------------------------------
⏷ Show the Full List of 46 Drug(s)
54 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Quercetin DM3NC4M Approved Quercetin decreases the phosphorylation of Serine/threonine-protein kinase mTOR (MTOR). [9]
Temozolomide DMKECZD Approved Temozolomide decreases the phosphorylation of Serine/threonine-protein kinase mTOR (MTOR). [10]
Hydrogen peroxide DM1NG5W Approved Hydrogen peroxide decreases the phosphorylation of Serine/threonine-protein kinase mTOR (MTOR). [12]
Hydroquinone DM6AVR4 Approved Hydroquinone decreases the phosphorylation of Serine/threonine-protein kinase mTOR (MTOR). [17]
Azathioprine DMMZSXQ Approved Azathioprine increases the phosphorylation of Serine/threonine-protein kinase mTOR (MTOR). [18]
Etoposide DMNH3PG Approved Etoposide increases the phosphorylation of Serine/threonine-protein kinase mTOR (MTOR). [20]
Paclitaxel DMLB81S Approved Paclitaxel decreases the phosphorylation of Serine/threonine-protein kinase mTOR (MTOR). [21]
Nicotine DMWX5CO Approved Nicotine increases the phosphorylation of Serine/threonine-protein kinase mTOR (MTOR). [22]
Dasatinib DMJV2EK Approved Dasatinib decreases the phosphorylation of Serine/threonine-protein kinase mTOR (MTOR). [23]
Capsaicin DMGMF6V Approved Capsaicin decreases the phosphorylation of Serine/threonine-protein kinase mTOR (MTOR). [24]
Methamphetamine DMPM4SK Approved Methamphetamine decreases the phosphorylation of Serine/threonine-protein kinase mTOR (MTOR). [25]
Daunorubicin DMQUSBT Approved Daunorubicin increases the phosphorylation of Serine/threonine-protein kinase mTOR (MTOR). [26]
Gefitinib DM15F0X Approved Gefitinib decreases the phosphorylation of Serine/threonine-protein kinase mTOR (MTOR). [28]
Sodium phenylbutyrate DMXLBCQ Approved Sodium phenylbutyrate decreases the phosphorylation of Serine/threonine-protein kinase mTOR (MTOR). [29]
Sertraline DM0FB1J Approved Sertraline decreases the phosphorylation of Serine/threonine-protein kinase mTOR (MTOR). [31]
Dopamine DMPGUCF Approved Dopamine decreases the phosphorylation of Serine/threonine-protein kinase mTOR (MTOR). [33]
Propofol DMB4OLE Approved Propofol decreases the phosphorylation of Serine/threonine-protein kinase mTOR (MTOR). [34]
Artesunate DMR27C8 Approved Artesunate decreases the phosphorylation of Serine/threonine-protein kinase mTOR (MTOR). [35]
Sevoflurane DMC9O43 Approved Sevoflurane decreases the phosphorylation of Serine/threonine-protein kinase mTOR (MTOR). [36]
Adenosine DMM2NSK Approved Adenosine increases the phosphorylation of Serine/threonine-protein kinase mTOR (MTOR). [37]
Nicotinamide DMUPE07 Approved Nicotinamide increases the phosphorylation of Serine/threonine-protein kinase mTOR (MTOR). [38]
Omacetaxine mepesuccinate DMPU2WX Approved Omacetaxine mepesuccinate decreases the phosphorylation of Serine/threonine-protein kinase mTOR (MTOR). [39]
Ropivacaine DMSPJG2 Approved Ropivacaine decreases the phosphorylation of Serine/threonine-protein kinase mTOR (MTOR). [40]
Trifluoperazine DMKBYWI Approved Trifluoperazine decreases the phosphorylation of Serine/threonine-protein kinase mTOR (MTOR). [41]
Momelotinib DMF98Q0 Approved Momelotinib decreases the phosphorylation of Serine/threonine-protein kinase mTOR (MTOR). [42]
Benzocaine DMI18HW Approved Benzocaine decreases the phosphorylation of Serine/threonine-protein kinase mTOR (MTOR). [44]
Rigosertib DMOSTXF Phase 3 Rigosertib decreases the phosphorylation of Serine/threonine-protein kinase mTOR (MTOR). [46]
Coprexa DMA0WEK Phase 3 Coprexa decreases the phosphorylation of Serine/threonine-protein kinase mTOR (MTOR). [47]
Bardoxolone methyl DMODA2X Phase 3 Bardoxolone methyl decreases the phosphorylation of Serine/threonine-protein kinase mTOR (MTOR). [48]
Buparlisib DM1WEHC Phase 3 Buparlisib increases the phosphorylation of Serine/threonine-protein kinase mTOR (MTOR). [49]
Thymoquinone DMVDTR2 Phase 2/3 Thymoquinone decreases the phosphorylation of Serine/threonine-protein kinase mTOR (MTOR). [52]
GSK2110183 DMZHB37 Phase 2 GSK2110183 decreases the phosphorylation of Serine/threonine-protein kinase mTOR (MTOR). [53]
phorbol 12-myristate 13-acetate DMJWD62 Phase 2 phorbol 12-myristate 13-acetate increases the phosphorylation of Serine/threonine-protein kinase mTOR (MTOR). [54]
Puerarin DMJIMXH Phase 2 Puerarin increases the phosphorylation of Serine/threonine-protein kinase mTOR (MTOR). [55]
URSOLIC ACID DM4SOAW Phase 2 URSOLIC ACID decreases the phosphorylation of Serine/threonine-protein kinase mTOR (MTOR). [57]
INK128 DMGO7QT Phase 2 INK128 decreases the phosphorylation of Serine/threonine-protein kinase mTOR (MTOR). [59]
Antroquinonol DMRGQVZ Phase 2 Antroquinonol decreases the phosphorylation of Serine/threonine-protein kinase mTOR (MTOR). [61]
G1 DMTV42K Phase 1/2 G1 increases the phosphorylation of Serine/threonine-protein kinase mTOR (MTOR). [62]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene affects the methylation of Serine/threonine-protein kinase mTOR (MTOR). [63]
Mivebresib DMCPF90 Phase 1 Mivebresib decreases the phosphorylation of Serine/threonine-protein kinase mTOR (MTOR). [64]
GSK618334 DMJPXZ4 Phase 1 GSK618334 decreases the phosphorylation of Serine/threonine-protein kinase mTOR (MTOR). [66]
Ribavirin DMEYLH9 Phase 1 Trial Ribavirin decreases the phosphorylation of Serine/threonine-protein kinase mTOR (MTOR). [67]
PMID26560530-Compound-35 DMO36RL Patented PMID26560530-Compound-35 decreases the phosphorylation of Serine/threonine-protein kinase mTOR (MTOR). [69]
EHT-1864 DMYAMP5 Terminated EHT-1864 decreases the phosphorylation of Serine/threonine-protein kinase mTOR (MTOR). [72]
Methylthioadenosine DMC8J6F Terminated Methylthioadenosine decreases the phosphorylation of Serine/threonine-protein kinase mTOR (MTOR). [73]
Bisphenol A DM2ZLD7 Investigative Bisphenol A increases the methylation of Serine/threonine-protein kinase mTOR (MTOR). [74]
Coumarin DM0N8ZM Investigative Coumarin affects the phosphorylation of Serine/threonine-protein kinase mTOR (MTOR). [75]
Acetaldehyde DMJFKG4 Investigative Acetaldehyde decreases the phosphorylation of Serine/threonine-protein kinase mTOR (MTOR). [76]
Paraquat DMR8O3X Investigative Paraquat decreases the phosphorylation of Serine/threonine-protein kinase mTOR (MTOR). [78]
D-glucose DMMG2TO Investigative D-glucose increases the phosphorylation of Serine/threonine-protein kinase mTOR (MTOR). [81]
Manganese DMKT129 Investigative Manganese decreases the phosphorylation of Serine/threonine-protein kinase mTOR (MTOR). [84]
Butanoic acid DMTAJP7 Investigative Butanoic acid decreases the phosphorylation of Serine/threonine-protein kinase mTOR (MTOR). [85]
Cordycepin DM72Y01 Investigative Cordycepin increases the phosphorylation of Serine/threonine-protein kinase mTOR (MTOR). [37]
Lead acetate DML0GZ2 Investigative Lead acetate increases the phosphorylation of Serine/threonine-protein kinase mTOR (MTOR). [87]
------------------------------------------------------------------------------------
⏷ Show the Full List of 54 Drug(s)

References

1 A germline MTOR mutation in Aboriginal Australian siblings with intellectual disability, dysmorphism, macrocephaly, and small thoraces. Am J Med Genet A. 2015 Jul;167(7):1659-67. doi: 10.1002/ajmg.a.37070. Epub 2015 Apr 6.
2 Technical standards for the interpretation and reporting of constitutional copy-number variants: a joint consensus recommendation of the American College of Medical Genetics and Genomics (ACMG) and the Clinical Genome Resource (ClinGen). Genet Med. 2020 Feb;22(2):245-257. doi: 10.1038/s41436-019-0686-8. Epub 2019 Nov 6.
3 Establishment of a 13 genes-based molecular prediction score model to discriminate the neurotoxic potential of food relevant-chemicals. Toxicol Lett. 2022 Feb 1;355:1-18. doi: 10.1016/j.toxlet.2021.10.013. Epub 2021 Nov 5.
4 Blood transcript immune signatures distinguish a subset of people with elevated serum ALT from others given acetaminophen. Clin Pharmacol Ther. 2016 Apr;99(4):432-41.
5 Loperamide potentiates doxorubicin sensitivity in triple-negative breast cancer cells by targeting MDR1 and JNK and suppressing mTOR and Bcl-2: In vitro and molecular docking study. J Biochem Mol Toxicol. 2022 Jan;36(1):e22938. doi: 10.1002/jbt.22938. Epub 2021 Oct 31.
6 The role of mTOR during cisplatin treatment in an in vitro and ex vivo model of cervical cancer. Toxicology. 2015 Sep 1;335:72-8. doi: 10.1016/j.tox.2015.07.010. Epub 2015 Jul 19.
7 Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
8 Involvement of epigenetics and EMT-related miRNA in arsenic-induced neoplastic transformation and their potential clinical use. Cancer Prev Res (Phila). 2015 Mar;8(3):208-21. doi: 10.1158/1940-6207.CAPR-14-0251. Epub 2015 Jan 13.
9 Quercetin inhibits angiogenesis mediated human prostate tumor growth by targeting VEGFR- 2 regulated AKT/mTOR/P70S6K signaling pathways. PLoS One. 2012;7(10):e47516. doi: 10.1371/journal.pone.0047516. Epub 2012 Oct 18.
10 Resveratrol enhances the antitumor effects of temozolomide in glioblastoma via ROS-dependent AMPK-TSC-mTOR signaling pathway. CNS Neurosci Ther. 2012 Jul;18(7):536-46. doi: 10.1111/j.1755-5949.2012.00319.x. Epub 2012 Apr 25.
11 A comprehensive analysis of Wnt/beta-catenin signaling pathway-related genes and crosstalk pathways in the treatment of As2O3 in renal cancer. Ren Fail. 2018 Nov;40(1):331-339.
12 Repression of Kisspeptin1 weakens hydrogen peroxide-caused injury in HTR8 cells via adjusting PI3K/AKT/mTOR pathway. J Biochem Mol Toxicol. 2020 May;34(5):e22461. doi: 10.1002/jbt.22461. Epub 2020 Feb 11.
13 SAHA induces caspase-independent, autophagic cell death of endometrial stromal sarcoma cells by influencing the mTOR pathway. J Pathol. 2008 Dec;216(4):495-504. doi: 10.1002/path.2434.
14 The human myometrium differentially expresses mTOR signalling components before and during pregnancy: evidence for regulation by progesterone. J Steroid Biochem Mol Biol. 2014 Jan;139:166-72. doi: 10.1016/j.jsbmb.2013.02.017. Epub 2013 Mar 26.
15 Niclosamide Exhibits Potent Anticancer Activity and Synergizes with Sorafenib in Human Renal Cell Cancer Cells. Cell Physiol Biochem. 2018;47(3):957-971. doi: 10.1159/000490140. Epub 2018 May 24.
16 Transcriptomic Analysis of Stem Cells Treated with Moringin or Cannabidiol: Analogies and Differences in Inflammation Pathways. Int J Mol Sci. 2019 Nov 30;20(23):6039. doi: 10.3390/ijms20236039.
17 Hydroquinone-induced endoplasmic reticulum stress affects TK6 cell autophagy and apoptosis via ATF6-mTOR. Environ Toxicol. 2023 Aug;38(8):1874-1890. doi: 10.1002/tox.23814. Epub 2023 May 6.
18 Azathioprine desensitizes liver cancer cells to insulin-like growth factor 1 and causes apoptosis when it is combined with bafilomycin A1. Toxicol Appl Pharmacol. 2013 Nov 1;272(3):568-78. doi: 10.1016/j.taap.2013.07.024. Epub 2013 Aug 16.
19 Autophagy as a compensation mechanism participates in ethanol-induced fetal adrenal dysfunction in female rats. Toxicol Appl Pharmacol. 2018 Apr 15;345:36-47.
20 CWF-145, a novel synthetic quinolone derivative exerts potent antimitotic activity against human prostate cancer: Rapamycin enhances antimitotic drug-induced apoptosis through the inhibition of Akt/mTOR pathway. Chem Biol Interact. 2016 Dec 25;260:1-12. doi: 10.1016/j.cbi.2016.10.014. Epub 2016 Oct 18.
21 Dieckol, a natural polyphenolic drug, inhibits the proliferation and migration of colon cancer cells by inhibiting PI3K, AKT, and mTOR phosphorylation. J Biochem Mol Toxicol. 2023 May;37(5):e23313. doi: 10.1002/jbt.23313. Epub 2023 Jan 22.
22 eIF4E is a critical regulator of human papillomavirus (HPV)-immortalized cervical epithelial (H8) cell growth induced by nicotine. Toxicology. 2019 May 1;419:1-10. doi: 10.1016/j.tox.2019.02.017. Epub 2019 Mar 2.
23 Dasatinib induces autophagic cell death in human ovarian cancer. Cancer. 2010 Nov 1;116(21):4980-90. doi: 10.1002/cncr.25426.
24 Role of autophagy in chemoresistance: regulation of the ATM-mediated DNA-damage signaling pathway through activation of DNA-PKcs and PARP-1. Biochem Pharmacol. 2012 Mar 15;83(6):747-57. doi: 10.1016/j.bcp.2011.12.029. Epub 2011 Dec 29.
25 Melatonin attenuates methamphetamine-induced deactivation of the mammalian target of rapamycin signaling to induce autophagy in SK-N-SH cells. J Pineal Res. 2009 Mar;46(2):199-206. doi: 10.1111/j.1600-079X.2008.00648.x. Epub 2008 Nov 19.
26 Antileukaemia effect of rapamycin alone or in combination with daunorubicin on Ph+ acute lymphoblastic leukaemia cell line. Hematol Oncol. 2012 Sep;30(3):123-30. doi: 10.1002/hon.1013. Epub 2011 Sep 4.
27 Novel carbocyclic curcumin analog CUR3d modulates genes involved in multiple apoptosis pathways in human hepatocellular carcinoma cells. Chem Biol Interact. 2015 Dec 5;242:107-22.
28 EGFR tyrosine kinase inhibitors activate autophagy as a cytoprotective response in human lung cancer cells. PLoS One. 2011;6(6):e18691. doi: 10.1371/journal.pone.0018691. Epub 2011 Jun 2.
29 Inhibition of ATF4-mediated elevation of both autophagy and AKT/mTOR was involved in antitumorigenic activity of curcumin. Food Chem Toxicol. 2023 Mar;173:113609. doi: 10.1016/j.fct.2023.113609. Epub 2023 Jan 12.
30 A systems biology understanding of the synergistic effects of arsenic sulfide and Imatinib in BCR/ABL-associated leukemia. Proc Natl Acad Sci U S A. 2009 Mar 3;106(9):3378-83.
31 Antidepressant drug sertraline modulates AMPK-MTOR signaling-mediated autophagy via targeting mitochondrial VDAC1 protein. Autophagy. 2021 Oct;17(10):2783-2799. doi: 10.1080/15548627.2020.1841953. Epub 2020 Nov 9.
32 Vitamin D3 induces autophagy of human myeloid leukemia cells. J Biol Chem. 2008 Sep 12;283(37):25596-25605. doi: 10.1074/jbc.M801716200. Epub 2008 Jul 15.
33 Effects of dopamine on LC3-II activation as a marker of autophagy in a neuroblastoma cell model. Neurotoxicology. 2009 Jul;30(4):658-65. doi: 10.1016/j.neuro.2009.04.007. Epub 2009 May 4.
34 Propofol suppresses proliferation, migration, invasion, and tumor growth of liver cancer cells via suppressing cancer susceptibility candidate 9/phosphatase and tensin homolog/AKT serine/threonine kinase/mechanistic target of rapamycin kinase axis. Hum Exp Toxicol. 2022 Jan-Dec;41:9603271211065972. doi: 10.1177/09603271211065972.
35 Artesunate induces autophagy dependent apoptosis through upregulating ROS and activating AMPK-mTOR-ULK1 axis in human bladder cancer cells. Chem Biol Interact. 2020 Nov 1;331:109273. doi: 10.1016/j.cbi.2020.109273. Epub 2020 Sep 28.
36 4.8% sevoflurane induces activation of autophagy in human neuroblastoma SH-SY5Y cells by the AMPK/mTOR signaling pathway. Neurotoxicology. 2022 May;90:256-264. doi: 10.1016/j.neuro.2022.04.008. Epub 2022 Apr 23.
37 Adenosine and Cordycepin Accelerate Tissue Remodeling Process through Adenosine Receptor Mediated Wnt/-Catenin Pathway Stimulation by Regulating GSK3b Activity. Int J Mol Sci. 2021 May 25;22(11):5571. doi: 10.3390/ijms22115571.
38 Resveratrol modulates tumor cell proliferation and protein translation via SIRT1-dependent AMPK activation. J Agric Food Chem. 2010 Feb 10;58(3):1584-92. doi: 10.1021/jf9035782.
39 Homoharringtonine suppresses LoVo cell growth by inhibiting EphB4 and the PI3K/AKT and MAPK/EKR1/2 signaling pathways. Food Chem Toxicol. 2020 Feb;136:110960. doi: 10.1016/j.fct.2019.110960. Epub 2019 Nov 11.
40 Ropivacaine inhibits proliferation?and invasion?and promotes apoptosis and autophagy in bladder cancer cells via inhibiting PI3K/AKT pathway. J Biochem Mol Toxicol. 2023 Jan;37(1):e23233. doi: 10.1002/jbt.23233. Epub 2022 Oct 3.
41 Stonin 2 activates lysosomal-mTOR axis for cell survival in oral cancer. Toxicol In Vitro. 2023 Apr;88:105561. doi: 10.1016/j.tiv.2023.105561. Epub 2023 Jan 23.
42 The effect of quercetin nanoparticle on cervical cancer progression by inducing apoptosis, autophagy and anti-proliferation via JAK2 suppression. Biomed Pharmacother. 2016 Aug;82:595-605. doi: 10.1016/j.biopha.2016.05.029. Epub 2016 Jun 9.
43 Tetrandrine and cepharanthine induce apoptosis through caspase cascade regulation, cell cycle arrest, MAPK activation and PI3K/Akt/mTOR signal modification in glucocorticoid resistant human leukemia Jurkat T cells. Chem Biol Interact. 2019 Sep 1;310:108726. doi: 10.1016/j.cbi.2019.108726. Epub 2019 Jun 28.
44 Nicotine-induced autophagy via AMPK/mTOR pathway exerts protective effect in colitis mouse model. Chem Biol Interact. 2020 Feb 1;317:108943. doi: 10.1016/j.cbi.2020.108943. Epub 2020 Jan 10.
45 Interactive gene expression pattern in prostate cancer cells exposed to phenolic antioxidants. Life Sci. 2002 Mar 1;70(15):1821-39.
46 Styryl sulfonyl compounds inhibit translation of cyclin D1 in mantle cell lymphoma cells. Oncogene. 2009 Mar 26;28(12):1518-28. doi: 10.1038/onc.2008.502. Epub 2009 Feb 9.
47 Copper deprivation enhances the chemosensitivity of pancreatic cancer to rapamycin by mTORC1/2 inhibition. Chem Biol Interact. 2023 Sep 1;382:110546. doi: 10.1016/j.cbi.2023.110546. Epub 2023 Jun 7.
48 Synthetic oleanane triterpenoid derivative CDDO-Me disrupts cellular bioenergetics to suppress pancreatic ductal adenocarcinoma via targeting SLC1A5. J Biochem Mol Toxicol. 2022 Nov;36(11):e23192. doi: 10.1002/jbt.23192. Epub 2022 Aug 5.
49 Combination PI3K/MEK inhibition promotes tumor apoptosis and regression in PIK3CA wild-type, KRAS mutant colorectal cancer. Cancer Lett. 2014 Jun 1;347(2):204-11. doi: 10.1016/j.canlet.2014.02.018. Epub 2014 Feb 24.
50 A new strategy for the rapid identification and validation of direct toxicity targets of psoralen-induced hepatotoxicity. Toxicol Lett. 2022 Jun 15;363:11-26. doi: 10.1016/j.toxlet.2022.05.002. Epub 2022 May 18.
51 Rebamipide suppresses 5-fluorouracil-induced cell death via the activation of Akt/mTOR pathway and regulates the expression of Bcl-2 family proteins. Toxicol In Vitro. 2018 Feb;46:284-293. doi: 10.1016/j.tiv.2017.10.019. Epub 2017 Oct 17.
52 Thymoquinone suppresses the proliferation of renal cell carcinoma cells via reactive oxygen species-induced apoptosis and reduces cell stemness. Environ Toxicol. 2019 Nov;34(11):1208-1220. doi: 10.1002/tox.22822. Epub 2019 Jul 12.
53 Novel ATP-competitive Akt inhibitor afuresertib suppresses the proliferation of malignant pleural mesothelioma cells. Cancer Med. 2017 Nov;6(11):2646-2659. doi: 10.1002/cam4.1179. Epub 2017 Sep 27.
54 Expression of endogenous retroviruses reflects increased usage of atypical enhancers in T cells. EMBO J. 2019 Jun 17;38(12):e101107. doi: 10.15252/embj.2018101107. Epub 2019 May 8.
55 GPR30 Activation Contributes to the Puerarin-Mediated Neuroprotection in MPP(+)-Induced SH-SY5Y Cell Death. J Mol Neurosci. 2017 Feb;61(2):227-234. doi: 10.1007/s12031-016-0856-y. Epub 2016 Oct 30.
56 Mechanisms of apoptosis induction by simultaneous inhibition of PI3K and FLT3-ITD in AML cells in the hypoxic bone marrow microenvironment. Cancer Lett. 2013 Feb 1;329(1):45-58. doi: 10.1016/j.canlet.2012.09.020. Epub 2012 Oct 2.
57 Ursolic acid induces autophagy in U87MG cells via ROS-dependent endoplasmic reticulum stress. Chem Biol Interact. 2014 Jul 25;218:28-41. doi: 10.1016/j.cbi.2014.04.017. Epub 2014 May 5.
58 -Caryophyllene induces apoptosis and inhibits cell proliferation by deregulation of STAT-3/mTOR/AKT signaling in human bladder cancer cells: An in vitro study. J Biochem Mol Toxicol. 2021 Oct;35(10):e22863. doi: 10.1002/jbt.22863. Epub 2021 Jul 28.
59 Dual mTOR inhibitor MLN0128 suppresses Merkel cell carcinoma (MCC) xenograft tumor growth. Oncotarget. 2016 Feb 9;7(6):6576-92. doi: 10.18632/oncotarget.5878.
60 Fucoxanthin prevents cell growth and induces apoptosis in endometrial cancer HEC-1A cells by the inhibition of the PI3K/Akt/mTOR pathway. J Biochem Mol Toxicol. 2022 Jun;36(6):e23027. doi: 10.1002/jbt.23027. Epub 2022 Mar 9.
61 Antroquinonol displays anticancer potential against human hepatocellular carcinoma cells: a crucial role of AMPK and mTOR pathways. Biochem Pharmacol. 2010 Jan 15;79(2):162-71. doi: 10.1016/j.bcp.2009.08.022. Epub 2009 Aug 31.
62 Bisphenol A and estrogen induce proliferation of human thyroid tumor cells via an estrogen-receptor-dependent pathway. Arch Biochem Biophys. 2017 Nov 1;633:29-39. doi: 10.1016/j.abb.2017.09.002. Epub 2017 Sep 4.
63 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
64 Superior efficacy of cotreatment with BET protein inhibitor and BCL2 or MCL1 inhibitor against AML blast progenitor cells. Blood Cancer J. 2019 Jan 15;9(2):4. doi: 10.1038/s41408-018-0165-5.
65 The vicious cycle between ferritinophagy and ROS production triggered EMT inhibition of gastric cancer cells was through p53/AKT/mTor pathway. Chem Biol Interact. 2020 Sep 1;328:109196. doi: 10.1016/j.cbi.2020.109196. Epub 2020 Jul 18.
66 FTY720 induces autophagy-related apoptosis and necroptosis in human glioblastoma cells. Toxicol Lett. 2015 Jul 2;236(1):43-59. doi: 10.1016/j.toxlet.2015.04.015. Epub 2015 May 1.
67 Ribavirin augments doxorubicin's efficacy in human hepatocellular carcinoma through inhibiting doxorubicin-induced eIF4E activation. J Biochem Mol Toxicol. 2018 Jan;32(1). doi: 10.1002/jbt.22007. Epub 2017 Nov 7.
68 Caffeine induces apoptosis by enhancement of autophagy via PI3K/Akt/mTOR/p70S6K inhibition. Autophagy. 2011 Feb;7(2):176-87. doi: 10.4161/auto.7.2.14074. Epub 2011 Feb 1.
69 Rottlerin induces autophagy which leads to apoptotic cell death through inhibition of PI3K/Akt/mTOR pathway in human pancreatic cancer stem cells. Biochem Pharmacol. 2012 Nov 1;84(9):1154-63. doi: 10.1016/j.bcp.2012.08.007. Epub 2012 Aug 15.
70 Rictor Undergoes Glycogen Synthase Kinase 3 (GSK3)-dependent, FBXW7-mediated Ubiquitination and Proteasomal Degradation. J Biol Chem. 2015 May 29;290(22):14120-9. doi: 10.1074/jbc.M114.633057. Epub 2015 Apr 20.
71 Molecular mechanism and inhibitory targets of dioscin in HepG2 cells. Food Chem Toxicol. 2018 Oct;120:143-154.
72 Rac GTPases in acute myeloid leukemia cells: Expression profile and biological effects of pharmacological inhibition. Toxicol Appl Pharmacol. 2022 May 1;442:115990. doi: 10.1016/j.taap.2022.115990. Epub 2022 Mar 22.
73 Selective PRMT5 Inhibitors Suppress Human CD8(+) T Cells by Upregulation of p53 and Impairment of the AKT Pathway Similar to the Tumor Metabolite MTA. Mol Cancer Ther. 2020 Feb;19(2):409-419. doi: 10.1158/1535-7163.MCT-19-0189. Epub 2019 Nov 11.
74 DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
75 Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
76 Acetaldehyde promotes rapamycin-dependent activation of p70(S6K) and glucose uptake despite inhibition of Akt and mTOR in dopaminergic SH-SY5Y human neuroblastoma cells. Exp Neurol. 2007 Jan;203(1):196-204. doi: 10.1016/j.expneurol.2006.08.002. Epub 2006 Sep 7.
77 A novel derivative of the natural agent deguelin for cancer chemoprevention and therapy. Cancer Prev Res (Phila). 2008 Dec;1(7):577-87. doi: 10.1158/1940-6207.CAPR-08-0184.
78 Inhibition of paraquat-induced autophagy accelerates the apoptotic cell death in neuroblastoma SH-SY5Y cells. Toxicol Sci. 2007 Jun;97(2):448-58. doi: 10.1093/toxsci/kfm040. Epub 2007 Mar 6.
79 Glyphosate-based herbicides at low doses affect canonical pathways in estrogen positive and negative breast cancer cell lines. PLoS One. 2019 Jul 11;14(7):e0219610. doi: 10.1371/journal.pone.0219610. eCollection 2019.
80 5-HT 2 receptor mediates high-fat diet-induced hepatic steatosis and very low density lipoprotein overproduction in rats. Obes Res Clin Pract. 2018 Jan-Feb;12(Suppl 2):16-28. doi: 10.1016/j.orcp.2016.03.015. Epub 2016 Apr 28.
81 FOXP1 inhibits high glucose-induced ECM accumulation and oxidative stress in mesangial cells. Chem Biol Interact. 2019 Nov 1;313:108818. doi: 10.1016/j.cbi.2019.108818. Epub 2019 Sep 5.
82 Geraniol induces cooperative interaction of apoptosis and autophagy to elicit cell death in PC-3 prostate cancer cells. Int J Oncol. 2012 May;40(5):1683-90. doi: 10.3892/ijo.2011.1318. Epub 2011 Dec 23.
83 Microarray analysis of H2O2-, HNE-, or tBH-treated ARPE-19 cells. Free Radic Biol Med. 2002 Nov 15;33(10):1419-32.
84 Signaling pathways mediating manganese-induced toxicity in human glioblastoma cells (u87). Neurochem Res. 2006 Oct;31(10):1211-8. doi: 10.1007/s11064-006-9178-8. Epub 2006 Oct 17.
85 Oxidative stress plays a key role in butyrate-mediated autophagy via Akt/mTOR pathway in hepatoma cells. Chem Biol Interact. 2017 Aug 1;273:99-106. doi: 10.1016/j.cbi.2017.06.001. Epub 2017 Jun 12.
86 [Effect of rapamycin on leukemia cell lines]. Zhongguo Shi Yan Xue Ye Xue Za Zhi. 2009 Aug;17(4):870-3.
87 SIRT1/mTOR pathway-mediated autophagy dysregulation promotes Pb-induced hepatic lipid accumulation in HepG2 cells. Environ Toxicol. 2022 Mar;37(3):549-563. doi: 10.1002/tox.23420. Epub 2021 Nov 29.
88 mTOR inhibition reverses acquired endocrine therapy resistance of breast cancer cells at the cell proliferation and gene-expression levels. Cancer Sci. 2008 Oct;99(10):1992-2003. doi: 10.1111/j.1349-7006.2008.00955.x.
89 The activity of trabectedin as a single agent or in combination with everolimus for clear cell carcinoma of the ovary. Clin Cancer Res. 2011 Jul 1;17(13):4462-73. doi: 10.1158/1078-0432.CCR-10-2987. Epub 2011 May 27.
90 Human breast cancer cells display different sensitivities to ABT-263 based on the level of survivin. Toxicol In Vitro. 2018 Feb;46:229-236. doi: 10.1016/j.tiv.2017.09.023. Epub 2017 Sep 23.