Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTI8C76M)

DOT Name Calcineurin B homologous protein 3 (TESC)
Synonyms Tescalcin; TSC
Gene Name TESC
Related Disease
Acute leukaemia ( )
Arteriosclerosis ( )
Atherosclerosis ( )
Autism spectrum disorder ( )
Clear cell renal carcinoma ( )
Cystic kidney disease ( )
Epilepsy ( )
Essential hypertension ( )
Familial adenomatous polyposis ( )
Fleck corneal dystrophy ( )
Focal epilepsy ( )
Hamartoma ( )
Kidney cancer ( )
Kidney neoplasm ( )
leukaemia ( )
Leukemia ( )
Lung adenocarcinoma ( )
Lung cancer ( )
Lung carcinoma ( )
Lymphangioleiomyomatosis ( )
Major depressive disorder ( )
Medulloblastoma ( )
Non-small-cell lung cancer ( )
Peutz-Jeghers syndrome ( )
Renal carcinoma ( )
Renal cell carcinoma ( )
Squamous cell carcinoma ( )
Angiomyolipoma ( )
Carcinoma ( )
Colorectal carcinoma ( )
Nephropathy ( )
Acute monocytic leukemia ( )
Acute myelogenous leukaemia ( )
Adult glioblastoma ( )
Advanced cancer ( )
Autism ( )
Cowden disease ( )
Gitelman syndrome ( )
Glioblastoma multiforme ( )
Intellectual disability ( )
Kaposi sarcoma ( )
Kidney angiomyolipoma ( )
Neuroblastoma ( )
Noonan syndrome with multiple lentigines ( )
Pneumothorax ( )
Tauopathy ( )
Tourette syndrome ( )
UniProt ID
CHP3_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF13405
Sequence
MGAAHSASEEVRELEGKTGFSSDQIEQLHRRFKQLSGDQPTIRKENFNNVPDLELNPIRS
KIVRAFFDNRNLRKGPSGLADEINFEDFLTIMSYFRPIDTTMDEEQVELSRKEKLRFLFH
MYDSDSDGRITLEEYRNVVEELLSGNPHIEKESARSIADGAMMEAASVCMGQMEPDQVYE
GITFEDFLKIWQGIDIETKMHVRFLNMETMALCH
Function
Functions as an integral cofactor in cell pH regulation by controlling plasma membrane-type Na(+)/H(+) exchange activity. Promotes the maturation, transport, cell surface stability and exchange activity of SLC9A1/NHE1 at the plasma membrane. Promotes the induction of hematopoietic stem cell differentiation toward megakaryocytic lineage. Essential for the coupling of ERK cascade activation with the expression of ETS family genes in megakaryocytic differentiation. Also involved in granulocytic differentiation in a ERK-dependent manner. Inhibits the phosphatase activity of calcineurin.
Tissue Specificity
Expressed in mature megakaryocytes and polymorphonuclear granulocytes (at protein level). Abundantly expressed in heart. Also expressed at a lower level in adult testis and salivary gland, and in the placenta.

Molecular Interaction Atlas (MIA) of This DOT

47 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Acute leukaemia DISDQFDI Strong Biomarker [1]
Arteriosclerosis DISK5QGC Strong Biomarker [2]
Atherosclerosis DISMN9J3 Strong Biomarker [2]
Autism spectrum disorder DISXK8NV Strong Genetic Variation [3]
Clear cell renal carcinoma DISBXRFJ Strong Altered Expression [4]
Cystic kidney disease DISRT1LM Strong Genetic Variation [5]
Epilepsy DISBB28L Strong Biomarker [6]
Essential hypertension DIS7WI98 Strong Genetic Variation [7]
Familial adenomatous polyposis DISW53RE Strong Biomarker [8]
Fleck corneal dystrophy DISERQJ1 Strong Genetic Variation [9]
Focal epilepsy DIS4LY5L Strong Biomarker [6]
Hamartoma DIS0I87H Strong Altered Expression [10]
Kidney cancer DISBIPKM Strong Biomarker [11]
Kidney neoplasm DISBNZTN Strong Altered Expression [12]
leukaemia DISS7D1V Strong Altered Expression [13]
Leukemia DISNAKFL Strong Altered Expression [13]
Lung adenocarcinoma DISD51WR Strong Genetic Variation [14]
Lung cancer DISCM4YA Strong Biomarker [15]
Lung carcinoma DISTR26C Strong Biomarker [15]
Lymphangioleiomyomatosis DISR0RNB Strong Biomarker [16]
Major depressive disorder DIS4CL3X Strong Genetic Variation [17]
Medulloblastoma DISZD2ZL Strong Genetic Variation [18]
Non-small-cell lung cancer DIS5Y6R9 Strong Biomarker [15]
Peutz-Jeghers syndrome DISF27ZJ Strong Biomarker [8]
Renal carcinoma DISER9XT Strong Biomarker [11]
Renal cell carcinoma DISQZ2X8 Strong Altered Expression [4]
Squamous cell carcinoma DISQVIFL Strong Altered Expression [19]
Angiomyolipoma DIS2L71N moderate Genetic Variation [20]
Carcinoma DISH9F1N moderate Genetic Variation [21]
Colorectal carcinoma DIS5PYL0 moderate Altered Expression [22]
Nephropathy DISXWP4P Disputed Biomarker [23]
Acute monocytic leukemia DIS28NEL Limited Biomarker [24]
Acute myelogenous leukaemia DISCSPTN Limited Biomarker [24]
Adult glioblastoma DISVP4LU Limited Biomarker [25]
Advanced cancer DISAT1Z9 Limited Genetic Variation [26]
Autism DISV4V1Z Limited Genetic Variation [27]
Cowden disease DISMYKCE Limited Biomarker [28]
Gitelman syndrome DISEM9V2 Limited Genetic Variation [29]
Glioblastoma multiforme DISK8246 Limited Biomarker [25]
Intellectual disability DISMBNXP Limited Biomarker [27]
Kaposi sarcoma DISC1H1Z Limited Altered Expression [30]
Kidney angiomyolipoma DISRCMMM Limited Biomarker [24]
Neuroblastoma DISVZBI4 Limited Genetic Variation [31]
Noonan syndrome with multiple lentigines DIS014D0 Limited Genetic Variation [32]
Pneumothorax DISP86H1 Limited Biomarker [33]
Tauopathy DISY2IPA Limited Biomarker [34]
Tourette syndrome DISX9D54 Limited Genetic Variation [35]
------------------------------------------------------------------------------------
⏷ Show the Full List of 47 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
14 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the expression of Calcineurin B homologous protein 3 (TESC). [36]
Ciclosporin DMAZJFX Approved Ciclosporin decreases the expression of Calcineurin B homologous protein 3 (TESC). [37]
Tretinoin DM49DUI Approved Tretinoin decreases the expression of Calcineurin B homologous protein 3 (TESC). [38]
Doxorubicin DMVP5YE Approved Doxorubicin decreases the expression of Calcineurin B homologous protein 3 (TESC). [39]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate decreases the expression of Calcineurin B homologous protein 3 (TESC). [40]
Cisplatin DMRHGI9 Approved Cisplatin decreases the expression of Calcineurin B homologous protein 3 (TESC). [41]
Triclosan DMZUR4N Approved Triclosan decreases the expression of Calcineurin B homologous protein 3 (TESC). [42]
Zoledronate DMIXC7G Approved Zoledronate decreases the expression of Calcineurin B homologous protein 3 (TESC). [43]
SNDX-275 DMH7W9X Phase 3 SNDX-275 increases the expression of Calcineurin B homologous protein 3 (TESC). [44]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the expression of Calcineurin B homologous protein 3 (TESC). [45]
(+)-JQ1 DM1CZSJ Phase 1 (+)-JQ1 decreases the expression of Calcineurin B homologous protein 3 (TESC). [46]
PMID28460551-Compound-2 DM4DOUB Patented PMID28460551-Compound-2 increases the expression of Calcineurin B homologous protein 3 (TESC). [47]
Bisphenol A DM2ZLD7 Investigative Bisphenol A affects the expression of Calcineurin B homologous protein 3 (TESC). [48]
Trichostatin A DM9C8NX Investigative Trichostatin A increases the expression of Calcineurin B homologous protein 3 (TESC). [49]
------------------------------------------------------------------------------------
⏷ Show the Full List of 14 Drug(s)

References

1 New insights into the role of the tuberous sclerosis genes in leukemia.Leuk Res. 2009 Jul;33(7):883-5. doi: 10.1016/j.leukres.2009.02.013. Epub 2009 Mar 16.
2 ED-B fibronectin (ED-B) can be targeted using a novel single chain antibody conjugate and is associated with macrophage accumulation in atherosclerotic lesions.Basic Res Cardiol. 2007 Jul;102(4):298-307. doi: 10.1007/s00395-007-0652-5. Epub 2007 Apr 30.
3 Gestational immune activation and Tsc2 haploinsufficiency cooperate to disrupt fetal survival and may perturb social behavior in adult mice.Mol Psychiatry. 2012 Jan;17(1):62-70. doi: 10.1038/mp.2010.115. Epub 2010 Nov 16.
4 Suppression of Tescalcin inhibits growth and metastasis in renal cell carcinoma via downregulating NHE1 and NF-kB signaling.Exp Mol Pathol. 2019 Apr;107:110-117. doi: 10.1016/j.yexmp.2018.12.004. Epub 2018 Dec 27.
5 Diagnosis of tuberous sclerosis complex in the fetus.Eur J Paediatr Neurol. 2018 Nov;22(6):1027-1034. doi: 10.1016/j.ejpn.2018.08.005. Epub 2018 Sep 12.
6 Contribution of ultrarare variants in mTOR pathway genes to sporadic focal epilepsies.Ann Clin Transl Neurol. 2019 Feb 25;6(3):475-485. doi: 10.1002/acn3.722. eCollection 2019 Mar.
7 Lack of an association between TSC gene Arg904Gln polymorphisms and essential hypertension risk based on a meta-analysis.Genet Mol Res. 2012 Sep 26;11(3):3511-7. doi: 10.4238/2012.September.26.7.
8 The tuberous sclerosis complex genes in tumor development.Cancer Invest. 2004;22(4):588-603. doi: 10.1081/cnv-200027144.
9 Focal cortical dysplasia: a genotype-phenotype analysis of polymorphisms and mutations in the TSC genes.Epilepsia. 2009 Jun;50(6):1396-408. doi: 10.1111/j.1528-1167.2008.01979.x. Epub 2009 Jan 21.
10 Loss of heterozygosity on tuberous sclerosis complex genes in multifocal micronodular pneumocyte hyperplasia.Mod Pathol. 2010 Sep;23(9):1251-60. doi: 10.1038/modpathol.2010.114. Epub 2010 Jun 4.
11 Renal cancer: molecular mechanisms and newer therapeutic options.Curr Opin Nephrol Hypertens. 2002 Jan;11(1):37-42. doi: 10.1097/00041552-200201000-00006.
12 Altered gene expression in phenotypically normal renal cells from carriers of tumor suppressor gene mutations.Cancer Biol Ther. 2004 Dec;3(12):1313-21. doi: 10.4161/cbt.3.12.1459. Epub 2004 Dec 9.
13 A novel tescalcin-sodium/hydrogen exchange axis underlying sorafenib resistance in FLT3-ITD+ AML.Blood. 2014 Apr 17;123(16):2530-9. doi: 10.1182/blood-2013-07-512194. Epub 2014 Mar 7.
14 Loss of heterozygosity on chromosomes 9q and 16p in atypical adenomatous hyperplasia concomitant with adenocarcinoma of the lung.Am J Pathol. 2001 Nov;159(5):1941-8. doi: 10.1016/S0002-9440(10)63041-6.
15 Tescalcin/c-Src/IGF1R-mediated STAT3 activation enhances cancer stemness and radioresistant properties through ALDH1.Sci Rep. 2018 Jul 16;8(1):10711. doi: 10.1038/s41598-018-29142-x.
16 Serum endostatin levels are associated with diffusion capacity and with tuberous sclerosis- associated lymphangioleiomyomatosis.Orphanet J Rare Dis. 2019 Mar 29;14(1):72. doi: 10.1186/s13023-019-1050-4.
17 TESC gene-regulating genetic variant (rs7294919) affects hippocampal subfield volumes and parahippocampal cingulum white matter integrity in major depressive disorder.J Psychiatr Res. 2017 Oct;93:20-29. doi: 10.1016/j.jpsychires.2017.05.010. Epub 2017 May 25.
18 Nervous system tumors associated with familial tumor syndromes.Curr Opin Neurol. 2010 Dec;23(6):583-91. doi: 10.1097/WCO.0b013e3283405b5f.
19 Involvement of TSC genes and differential expression of other members of the mTOR signaling pathway in oral squamous cell carcinoma.BMC Cancer. 2008 Jun 6;8:163. doi: 10.1186/1471-2407-8-163.
20 Response to everolimus is seen in TSC-associated SEGAs and angiomyolipomas independent of mutation type and site in TSC1 and TSC2.Eur J Hum Genet. 2015 Dec;23(12):1665-72. doi: 10.1038/ejhg.2015.47. Epub 2015 Mar 18.
21 Rapamycin-upregulated miR-29b promotes mTORC1-hyperactive cell growth in TSC2-deficient cells by downregulating tumor suppressor retinoic acid receptor (RAR).Oncogene. 2019 Dec;38(49):7367-7383. doi: 10.1038/s41388-019-0957-5. Epub 2019 Aug 16.
22 Analysis of the clinical significance of DCLK1(+) colorectal cancer using novel monoclonal antibodies against DCLK1.Onco Targets Ther. 2018 Aug 21;11:5047-5057. doi: 10.2147/OTT.S169928. eCollection 2018.
23 Renal angiomyolipomas, cysts, and cancer in tuberous sclerosis complex.Semin Pediatr Neurol. 1998 Dec;5(4):269-75. doi: 10.1016/s1071-9091(98)80005-3.
24 How many surgically-treated angiomyolipomas are related to tuberous sclerosis complex? Insights from a retrospective multicenter study.Minerva Urol Nefrol. 2020 Apr;72(2):200-206. doi: 10.23736/S0393-2249.19.03522-7. Epub 2019 Oct 10.
25 Mutations of the MAPK/TSC/mTOR pathway characterize periventricular glioblastoma with epithelioid SEGA-like morphology-morphological and therapeutic implications.Oncotarget. 2019 Jun 18;10(40):4038-4052. doi: 10.18632/oncotarget.27005. eCollection 2019 Jun 18.
26 Allosteric and ATP-Competitive Inhibitors of mTOR Effectively Suppress Tumor Progression-Associated Epithelial-Mesenchymal Transition in the Kidneys of Tsc2(+/-) Mice.Neoplasia. 2019 Aug;21(8):731-739. doi: 10.1016/j.neo.2019.05.003. Epub 2019 Jun 14.
27 Autism and tuberous sclerosis.J Autism Dev Disord. 1998 Oct;28(5):407-14. doi: 10.1023/a:1026052421693.
28 Tuberous sclerosis and insulin resistance. Unlikely bedfellows reveal a TORrid affair.Cell Cycle. 2005 Jan;4(1):46-51. doi: 10.4161/cc.4.1.1343. Epub 2005 Jan 3.
29 Two novel mutations of thiazide-sensitive Na-Cl cotrans porter (TSC) gene in two sporadic Japanese patients with Gitelman syndrome.Endocr J. 2002 Feb;49(1):91-6. doi: 10.1507/endocrj.49.91.
30 Amplification of the angiogenic signal through the activation of the TSC/mTOR/HIF axis by the KSHV vGPCR in Kaposi's sarcoma.PLoS One. 2011 Apr 29;6(4):e19103. doi: 10.1371/journal.pone.0019103.
31 Eosinophilic Solid and Cystic (ESC) Renal Cell Carcinomas Harbor TSC Mutations: Molecular Analysis Supports an Expanding Clinicopathologic Spectrum.Am J Surg Pathol. 2018 Sep;42(9):1166-1181. doi: 10.1097/PAS.0000000000001111.
32 Conservation of structural and functional elements of TSC1 and TSC2: a bioinformatic comparison across animal models.Behav Genet. 2011 May;41(3):349-56. doi: 10.1007/s10519-010-9440-3. Epub 2011 Jan 18.
33 Total pleural coverage followed by lung transplantation in patient with lymphangioleiomyomatosis.Gen Thorac Cardiovasc Surg. 2020 Oct;68(10):1208-1211. doi: 10.1007/s11748-019-01217-0. Epub 2019 Oct 14.
34 Infantile tauopathies: Hemimegalencephaly; tuberous sclerosis complex; focal cortical dysplasia 2; ganglioglioma.Brain Dev. 2015 Jun;37(6):553-62. doi: 10.1016/j.braindev.2014.08.010. Epub 2014 Oct 19.
35 Inhibition of ERK1/2 Restores GSK3 Activity and Protein Synthesis Levels in a Model of Tuberous Sclerosis.Sci Rep. 2017 Jun 23;7(1):4174. doi: 10.1038/s41598-017-04528-5.
36 Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
37 Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
38 Phenotypic characterization of retinoic acid differentiated SH-SY5Y cells by transcriptional profiling. PLoS One. 2013 May 28;8(5):e63862.
39 Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
40 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
41 Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
42 Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
43 Interleukin-19 as a translational indicator of renal injury. Arch Toxicol. 2015 Jan;89(1):101-6.
44 A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
45 Transcriptional signature of human macrophages exposed to the environmental contaminant benzo(a)pyrene. Toxicol Sci. 2010 Apr;114(2):247-59.
46 Bromodomain-containing protein 4 (BRD4) regulates RNA polymerase II serine 2 phosphorylation in human CD4+ T cells. J Biol Chem. 2012 Dec 14;287(51):43137-55.
47 Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
48 Comprehensive analysis of transcriptomic changes induced by low and high doses of bisphenol A in HepG2 spheroids in vitro and rat liver in vivo. Environ Res. 2019 Jun;173:124-134. doi: 10.1016/j.envres.2019.03.035. Epub 2019 Mar 18.
49 From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.