Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTIEXTDK)

• DOT Name: G2/mitotic-specific cyclin-B2 (CCNB2)
• Gene Name: CCNB2
• Related Disease:
  Bone osteosarcoma
  Osteosarcoma
  Adrenal cortex neoplasm
  Adult respiratory distress syndrome
  Advanced cancer
  Ataxia-telangiectasia
  Bladder cancer
  Carcinoma
  Dilated cardiomyopathy 1A
  Glioma
  Hepatocellular carcinoma
  Lung carcinoma
  Lung neoplasm
  Lung squamous cell carcinoma
  Neoplasm
  Non-small-cell lung cancer
  Rectal adenocarcinoma
  Stomach cancer
  Urinary bladder cancer
  Urinary bladder neoplasm
  Gastric cancer
  Laryngeal squamous cell carcinoma
  Adenocarcinoma
  Breast cancer
  Breast carcinoma
  Castration-resistant prostate carcinoma
  Clear cell adenocarcinoma
  Pituitary tumor
• UniProt ID: CCNB2_HUMAN
• Pfam ID: PF02984 ; PF00134
• Sequence:
  MALLRRPTVSSDLENIDTGVNSKVKSHVTIRRTVLEEIGNRVTTRAAQVAKKAQNTKVPV
  QPTKTTNVNKQLKPTASVKPVQMEKLAPKGPSPTPEDVSMKEENLCQAFSDALLCKIEDI
  DNEDWENPQLCSDYVKDIYQYLRQLEVLQSINPHFLDGRDINGRMRAILVDWLVQVHSKF
  RLLQETLYMCVGIMDRFLQVQPVSRKKLQLVGITALLLASKYEEMFSPNIEDFVYITDNA
  YTSSQIREMETLILKELKFELGRPLPLHFLRRASKAGEVDVEQHTLAKYLMELTLIDYDM
  VHYHPSKVAAAASCLSQKVLGQGKWNLKQQYYTGYTENEVLEVMQHMAKNVVKVNENLTK
  FIAIKNKYASSKLLKISMIPQLNSKAVKDLASPLIGRS
• Function: Essential for the control of the cell cycle at the G2/M (mitosis) transition.
• KEGG Pathway:
  FoxO sig.ling pathway (hsa04068)
  Cell cycle (hsa04110)
  Oocyte meiosis (hsa04114)
  p53 sig.ling pathway (hsa04115)
  Cellular senescence (hsa04218)
  Progesterone-mediated oocyte maturation (hsa04914)
  Human T-cell leukemia virus 1 infection (hsa05166)
  Human immunodeficiency virus 1 infection (hsa05170)
• Reactome Pathway:
  Golgi Cisternae Pericentriolar Stack Reorganization (R-HSA-162658)
  Resolution of Sister Chromatid Cohesion (R-HSA-2500257)
  Condensation of Prometaphase Chromosomes (R-HSA-2514853)
  Regulation of PLK1 Activity at G2/M Transition (R-HSA-2565942)
  Activation of NIMA Kinases NEK9, NEK6, NEK7 (R-HSA-2980767)
  Initiation of Nuclear Envelope (NE) Reformation (R-HSA-2995383)
  Nuclear Pore Complex (NPC) Disassembly (R-HSA-3301854)
  Cyclin A/B1/B2 associated events during G2/M transition (R-HSA-69273)
  G2/M DNA replication checkpoint (R-HSA-69478)
  The role of GTSE1 in G2/M progression after G2 checkpoint (R-HSA-8852276)
  Polo-like kinase mediated events (R-HSA-156711)

Molecular Interaction Atlas (MIA) of This DOT

28 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Bone osteosarcoma	DIST1004	Definitive	Biomarker	[1]
Osteosarcoma	DISLQ7E2	Definitive	Biomarker	[1]
Adrenal cortex neoplasm	DISO17X1	Strong	Biomarker	[2]
Adult respiratory distress syndrome	DISIJV47	Strong	Genetic Variation	[3]
Advanced cancer	DISAT1Z9	Strong	Altered Expression	[4]
Ataxia-telangiectasia	DISP3EVR	Strong	Altered Expression	[5]
Bladder cancer	DISUHNM0	Strong	Biomarker	[6]
Carcinoma	DISH9F1N	Strong	Genetic Variation	[7]
Dilated cardiomyopathy 1A	DIS0RK9Z	Strong	Genetic Variation	[8]
Glioma	DIS5RPEH	Strong	Biomarker	[9]
Hepatocellular carcinoma	DIS0J828	Strong	Altered Expression	[4]
Lung carcinoma	DISTR26C	Strong	Altered Expression	[10]
Lung neoplasm	DISVARNB	Strong	Altered Expression	[10]
Lung squamous cell carcinoma	DISXPIBD	Strong	Biomarker	[11]
Neoplasm	DISZKGEW	Strong	Altered Expression	[4]
Non-small-cell lung cancer	DIS5Y6R9	Strong	Altered Expression	[12]
Rectal adenocarcinoma	DIS8R9VO	Strong	Biomarker	[13]
Stomach cancer	DISKIJSX	Strong	Biomarker	[14]
Urinary bladder cancer	DISDV4T7	Strong	Biomarker	[6]
Urinary bladder neoplasm	DIS7HACE	Strong	Biomarker	[6]
Gastric cancer	DISXGOUK	moderate	Biomarker	[14]
Laryngeal squamous cell carcinoma	DIS9UUVF	moderate	Biomarker	[15]
Adenocarcinoma	DIS3IHTY	Limited	Biomarker	[16]
Breast cancer	DIS7DPX1	Limited	Altered Expression	[17]
Breast carcinoma	DIS2UE88	Limited	Altered Expression	[17]
Castration-resistant prostate carcinoma	DISVGAE6	Limited	Altered Expression	[18]
Clear cell adenocarcinoma	DISYUGHZ	Limited	Altered Expression	[19]
Pituitary tumor	DISN67JD	Limited	Altered Expression	[20]

This DOT Affected the Drug Response of 3 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Paclitaxel	DMLB81S	Approved	G2/mitotic-specific cyclin-B2 (CCNB2) affects the response to substance of Paclitaxel.	[68]
Topotecan	DMP6G8T	Approved	G2/mitotic-specific cyclin-B2 (CCNB2) affects the response to substance of Topotecan.	[68]
Vinblastine	DM5TVS3	Approved	G2/mitotic-specific cyclin-B2 (CCNB2) affects the response to substance of Vinblastine.	[68]

50 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of G2/mitotic-specific cyclin-B2 (CCNB2).	[21]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of G2/mitotic-specific cyclin-B2 (CCNB2).	[22]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of G2/mitotic-specific cyclin-B2 (CCNB2).	[23]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of G2/mitotic-specific cyclin-B2 (CCNB2).	[24]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of G2/mitotic-specific cyclin-B2 (CCNB2).	[25]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of G2/mitotic-specific cyclin-B2 (CCNB2).	[26]
Quercetin	DM3NC4M	Approved	Quercetin decreases the expression of G2/mitotic-specific cyclin-B2 (CCNB2).	[27]
Temozolomide	DMKECZD	Approved	Temozolomide increases the expression of G2/mitotic-specific cyclin-B2 (CCNB2).	[28]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide increases the expression of G2/mitotic-specific cyclin-B2 (CCNB2).	[29]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide affects the expression of G2/mitotic-specific cyclin-B2 (CCNB2).	[30]
Calcitriol	DM8ZVJ7	Approved	Calcitriol affects the expression of G2/mitotic-specific cyclin-B2 (CCNB2).	[31]
Testosterone	DM7HUNW	Approved	Testosterone decreases the expression of G2/mitotic-specific cyclin-B2 (CCNB2).	[31]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of G2/mitotic-specific cyclin-B2 (CCNB2).	[32]
Methotrexate	DM2TEOL	Approved	Methotrexate decreases the expression of G2/mitotic-specific cyclin-B2 (CCNB2).	[33]
Zoledronate	DMIXC7G	Approved	Zoledronate decreases the expression of G2/mitotic-specific cyclin-B2 (CCNB2).	[34]
Progesterone	DMUY35B	Approved	Progesterone decreases the expression of G2/mitotic-specific cyclin-B2 (CCNB2).	[35]
Menadione	DMSJDTY	Approved	Menadione affects the expression of G2/mitotic-specific cyclin-B2 (CCNB2).	[30]
Fluorouracil	DMUM7HZ	Approved	Fluorouracil decreases the expression of G2/mitotic-specific cyclin-B2 (CCNB2).	[36]
Fulvestrant	DM0YZC6	Approved	Fulvestrant decreases the expression of G2/mitotic-specific cyclin-B2 (CCNB2).	[37]
Cannabidiol	DM0659E	Approved	Cannabidiol decreases the expression of G2/mitotic-specific cyclin-B2 (CCNB2).	[38]
Troglitazone	DM3VFPD	Approved	Troglitazone decreases the expression of G2/mitotic-specific cyclin-B2 (CCNB2).	[39]
Irinotecan	DMP6SC2	Approved	Irinotecan decreases the expression of G2/mitotic-specific cyclin-B2 (CCNB2).	[40]
Piroxicam	DMTK234	Approved	Piroxicam decreases the expression of G2/mitotic-specific cyclin-B2 (CCNB2).	[41]
Lucanthone	DMZLBUO	Approved	Lucanthone decreases the expression of G2/mitotic-specific cyclin-B2 (CCNB2).	[42]
Methamphetamine	DMPM4SK	Approved	Methamphetamine decreases the expression of G2/mitotic-specific cyclin-B2 (CCNB2).	[43]
Palbociclib	DMD7L94	Approved	Palbociclib decreases the expression of G2/mitotic-specific cyclin-B2 (CCNB2).	[44]
Tacrolimus	DMZ7XNQ	Approved	Tacrolimus decreases the expression of G2/mitotic-specific cyclin-B2 (CCNB2).	[23]
LY2835219	DM93VBZ	Approved	LY2835219 decreases the expression of G2/mitotic-specific cyclin-B2 (CCNB2).	[45]
Trabectedin	DMG3Y89	Approved	Trabectedin decreases the expression of G2/mitotic-specific cyclin-B2 (CCNB2).	[46]
Isoflavone	DM7U58J	Phase 4	Isoflavone decreases the expression of G2/mitotic-specific cyclin-B2 (CCNB2).	[47]
Resveratrol	DM3RWXL	Phase 3	Resveratrol decreases the expression of G2/mitotic-specific cyclin-B2 (CCNB2).	[48]
Chlorpromazine	DMBGZI3	Phase 3 Trial	Chlorpromazine decreases the expression of G2/mitotic-specific cyclin-B2 (CCNB2).	[49]
Genistein	DM0JETC	Phase 2/3	Genistein decreases the expression of G2/mitotic-specific cyclin-B2 (CCNB2).	[50]
phorbol 12-myristate 13-acetate	DMJWD62	Phase 2	phorbol 12-myristate 13-acetate increases the expression of G2/mitotic-specific cyclin-B2 (CCNB2).	[51]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of G2/mitotic-specific cyclin-B2 (CCNB2).	[52]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of G2/mitotic-specific cyclin-B2 (CCNB2).	[53]
Leflunomide	DMR8ONJ	Phase 1 Trial	Leflunomide decreases the expression of G2/mitotic-specific cyclin-B2 (CCNB2).	[54]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of G2/mitotic-specific cyclin-B2 (CCNB2).	[55]
Scriptaid	DM9JZ21	Preclinical	Scriptaid affects the expression of G2/mitotic-specific cyclin-B2 (CCNB2).	[56]
EMODIN	DMAEDQG	Terminated	EMODIN decreases the expression of G2/mitotic-specific cyclin-B2 (CCNB2).	[57]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A decreases the expression of G2/mitotic-specific cyclin-B2 (CCNB2).	[59]
Coumestrol	DM40TBU	Investigative	Coumestrol increases the expression of G2/mitotic-specific cyclin-B2 (CCNB2).	[60]
Sulforaphane	DMQY3L0	Investigative	Sulforaphane increases the expression of G2/mitotic-specific cyclin-B2 (CCNB2).	[61]
Deguelin	DMXT7WG	Investigative	Deguelin increases the expression of G2/mitotic-specific cyclin-B2 (CCNB2).	[62]
Nickel chloride	DMI12Y8	Investigative	Nickel chloride increases the expression of G2/mitotic-specific cyclin-B2 (CCNB2).	[29]
Lithium chloride	DMHYLQ2	Investigative	Lithium chloride decreases the expression of G2/mitotic-specific cyclin-B2 (CCNB2).	[63]
Manganese	DMKT129	Investigative	Manganese decreases the expression of G2/mitotic-specific cyclin-B2 (CCNB2).	[64]
Butanoic acid	DMTAJP7	Investigative	Butanoic acid decreases the expression of G2/mitotic-specific cyclin-B2 (CCNB2).	[65]
Okadaic acid	DM47CO1	Investigative	Okadaic acid affects the expression of G2/mitotic-specific cyclin-B2 (CCNB2).	[66]
Dibutyl phthalate	DMEDGKO	Investigative	Dibutyl phthalate decreases the expression of G2/mitotic-specific cyclin-B2 (CCNB2).	[67]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the methylation of G2/mitotic-specific cyclin-B2 (CCNB2).	[58]

References

• [1] CDC20 and its downstream genes: potential prognosis factors of osteosarcoma.Int J Clin Oncol. 2019 Nov;24(11):1479-1489. doi: 10.1007/s10147-019-01500-3. Epub 2019 Jul 5.
• [2] Expression profiles analysis identifies the values of carcinogenesis and the prognostic prediction of three genes in adrenocortical carcinoma.Oncol Rep. 2019 Apr;41(4):2440-2452. doi: 10.3892/or.2019.7021. Epub 2019 Feb 19.
• [3] Candidate genes and pathogenesis investigation for sepsis-related acute respiratory distress syndrome based on gene expression profile.Biol Res. 2016 Apr 18;49:25. doi: 10.1186/s40659-016-0085-4.
• [4] Cyclin B2 Overexpression in Human Hepatocellular Carcinoma is Associatedwith Poor Prognosis.Arch Med Res. 2019 Jan;50(1):10-17. doi: 10.1016/j.arcmed.2019.03.003. Epub 2019 Apr 4.
• [5] Middle infrared radiation induces G2/M cell cycle arrest in A549 lung cancer cells.PLoS One. 2013;8(1):e54117. doi: 10.1371/journal.pone.0054117. Epub 2013 Jan 15.
• [6] The decrease of cyclin B2 expression inhibits invasion and metastasis of bladder cancer.Urol Oncol. 2016 May;34(5):237.e1-10. doi: 10.1016/j.urolonc.2015.11.011. Epub 2015 Dec 17.
• [7] Tumour suppressor gene expression correlates with gastric cancer prognosis.J Pathol. 2003 May;200(1):39-46. doi: 10.1002/path.1288.
• [8] Age-specific gene expression signatures for breast tumors and cross-species conserved potential cancer progression markers in young women.PLoS One. 2013 May 21;8(5):e63204. doi: 10.1371/journal.pone.0063204. Print 2013.
• [9] Three meta-analyses define a set of commonly overexpressed genes from microarray datasets on astrocytomas.Mol Neurobiol. 2013 Feb;47(1):325-36. doi: 10.1007/s12035-012-8367-5. Epub 2012 Nov 8.
• [10] Discrimination of human lung neoplasm from normal lung by two target genes.Am J Respir Crit Care Med. 2004 Sep 1;170(5):516-9. doi: 10.1164/rccm.200401-127OC.
• [11] Co-Expression Network Analysis Identified Genes Associated with Cancer Stem Cell Characteristics in Lung Squamous Cell Carcinoma.Cancer Invest. 2020 Jan;38(1):13-22. doi: 10.1080/07357907.2019.1697281. Epub 2019 Dec 6.
• [12] CCNB2 overexpression is a poor prognostic biomarker in Chinese NSCLC patients.Biomed Pharmacother. 2015 Aug;74:222-7. doi: 10.1016/j.biopha.2015.08.004. Epub 2015 Aug 28.
• [13] Screening key lncRNAs for human rectal adenocarcinoma based on lncRNA-mRNA functional synergistic network.Cancer Med. 2019 Jul;8(8):3875-3891. doi: 10.1002/cam4.2236. Epub 2019 May 22.
• [14] Clinical significance and biological roles of cyclins in gastric cancer.Onco Targets Ther. 2018 Oct 9;11:6673-6685. doi: 10.2147/OTT.S171716. eCollection 2018.
• [15] Recurrent CDK1 overexpression in laryngeal squamous cell carcinoma.Tumour Biol. 2016 Aug;37(8):11115-26. doi: 10.1007/s13277-016-4991-4. Epub 2016 Feb 24.
• [16] Usefulness of CDK5RAP3, CCNB2, and RAGE genes for the diagnosis of lung adenocarcinoma.Int J Biol Markers. 2007 Apr-Jun;22(2):108-13. doi: 10.1177/172460080702200204.
• [17] Elevated cyclin B2 expression in invasive breast carcinoma is associated with unfavorable clinical outcome.BMC Cancer. 2013 Jan 2;13:1. doi: 10.1186/1471-2407-13-1.
• [18] Identification of genes associated with castrationresistant prostate cancer by gene expression profile analysis.Mol Med Rep. 2017 Nov;16(5):6803-6813. doi: 10.3892/mmr.2017.7488. Epub 2017 Sep 13.
• [19] Transcriptomic Characterization of Endometrioid, Clear Cell, and High-Grade Serous Epithelial Ovarian Carcinoma.Cancer Epidemiol Biomarkers Prev. 2018 Sep;27(9):1101-1109. doi: 10.1158/1055-9965.EPI-17-0728. Epub 2018 Jul 2.
• [20] HMGA proteins up-regulate CCNB2 gene in mouse and human pituitary adenomas.Cancer Res. 2009 Mar 1;69(5):1844-50. doi: 10.1158/0008-5472.CAN-08-4133. Epub 2009 Feb 17.
• [21] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [22] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [23] CyclinB2 and BIRC5 genes as surrogate biomarkers for neurite outgrowth in SH-SY5Y subclonal cells. Neuropharmacology. 2006 Jun;50(8):1041-7. doi: 10.1016/j.neuropharm.2006.02.004. Epub 2006 Mar 30.
• [24] RNA sequence analysis of inducible pluripotent stem cell-derived cardiomyocytes reveals altered expression of DNA damage and cell cycle genes in response to doxorubicin. Toxicol Appl Pharmacol. 2018 Oct 1;356:44-53.
• [25] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [26] Arsenite and cadmium promote the development of mammary tumors. Carcinogenesis. 2020 Jul 14;41(7):1005-1014. doi: 10.1093/carcin/bgz176.
• [27] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [28] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [29] Classification of heavy-metal toxicity by human DNA microarray analysis. Environ Sci Technol. 2007 May 15;41(10):3769-74.
• [30] Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
• [31] Effects of 1alpha,25 dihydroxyvitamin D3 and testosterone on miRNA and mRNA expression in LNCaP cells. Mol Cancer. 2011 May 18;10:58.
• [32] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [33] Methotrexate modulates folate phenotype and inflammatory profile in EA.hy 926 cells. Eur J Pharmacol. 2014 Jun 5;732:60-7.
• [34] Interleukin-19 as a translational indicator of renal injury. Arch Toxicol. 2015 Jan;89(1):101-6.
• [35] Effects of progesterone treatment on expression of genes involved in uterine quiescence. Reprod Sci. 2011 Aug;18(8):781-97.
• [36] Transcriptional profiling of MCF7 breast cancer cells in response to 5-Fluorouracil: relationship with cell cycle changes and apoptosis, and identification of novel targets of p53. Int J Cancer. 2006 Sep 1;119(5):1164-75.
• [37] mTOR inhibition reverses acquired endocrine therapy resistance of breast cancer cells at the cell proliferation and gene-expression levels. Cancer Sci. 2008 Oct;99(10):1992-2003. doi: 10.1111/j.1349-7006.2008.00955.x.
• [38] Cannabidiol-induced transcriptomic changes and cellular senescence in human Sertoli cells. Toxicol Sci. 2023 Feb 17;191(2):227-238. doi: 10.1093/toxsci/kfac131.
• [39] Effects of ciglitazone and troglitazone on the proliferation of human stomach cancer cells. World J Gastroenterol. 2009 Jan 21;15(3):310-20.
• [40] In vitro and in vivo irinotecan-induced changes in expression profiles of cell cycle and apoptosis-associated genes in acute myeloid leukemia cells. Mol Cancer Ther. 2005 Jun;4(6):885-900.
• [41] Apoptosis induced by piroxicam plus cisplatin combined treatment is triggered by p21 in mesothelioma. PLoS One. 2011;6(8):e23569.
• [42] Lucanthone is a novel inhibitor of autophagy that induces cathepsin D-mediated apoptosis. J Biol Chem. 2011 Feb 25;286(8):6602-13.
• [43] Methamphetamine alters the normal progression by inducing cell cycle arrest in astrocytes. PLoS One. 2014 Oct 7;9(10):e109603.
• [44] Cdk4/6 inhibition induces epithelial-mesenchymal transition and enhances invasiveness in pancreatic cancer cells. Mol Cancer Ther. 2012 Oct;11(10):2138-48. doi: 10.1158/1535-7163.MCT-12-0562. Epub 2012 Aug 6.
• [45] Biological specificity of CDK4/6 inhibitors: dose response relationship, in vivo signaling, and composite response signature. Oncotarget. 2017 Jul 4;8(27):43678-43691. doi: 10.18632/oncotarget.18435.
• [46] Selective effects of the anticancer drug Yondelis (ET-743) on cell-cycle promoters. Mol Pharmacol. 2005 Nov;68(5):1496-503. doi: 10.1124/mol.105.013615. Epub 2005 Jun 16.
• [47] Soy isoflavones exert differential effects on androgen responsive genes in LNCaP human prostate cancer cells. J Nutr. 2007 Apr;137(4):964-72.
• [48] Resveratrol-induced gene expression profiles in human prostate cancer cells. Cancer Epidemiol Biomarkers Prev. 2005 Mar;14(3):596-604. doi: 10.1158/1055-9965.EPI-04-0398.
• [49] Effects of chlorpromazine with and without UV irradiation on gene expression of HepG2 cells. Mutat Res. 2005 Aug 4;575(1-2):47-60. doi: 10.1016/j.mrfmmm.2005.03.002. Epub 2005 Apr 26.
• [50] Molecular signatures of soy-derived phytochemicals in androgen-responsive prostate cancer cells: a comparison study using DNA microarray. Mol Carcinog. 2006 Dec;45(12):943-56.
• [51] Comparison of gene expression profiles in HepG2 cells exposed to arsenic, cadmium, nickel, and three model carcinogens for investigating the mechanisms of metal carcinogenesis. Environ Mol Mutagen. 2009 Jan;50(1):46-59.
• [52] Transcriptional signature of human macrophages exposed to the environmental contaminant benzo(a)pyrene. Toxicol Sci. 2010 Apr;114(2):247-59.
• [53] BET protein inhibitor JQ1 inhibits growth and modulates WNT signaling in mesenchymal stem cells. Stem Cell Res Ther. 2016 Feb 1;7:22. doi: 10.1186/s13287-016-0278-3.
• [54] Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
• [55] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [56] Histone deacetylase inhibitor scriptaid induces cell cycle arrest and epigenetic change in colon cancer cells. Int J Oncol. 2008 Oct;33(4):767-76.
• [57] Gene expression alteration during redox-dependent enhancement of arsenic cytotoxicity by emodin in HeLa cells. Cell Res. 2005 Jul;15(7):511-22.
• [58] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
• [59] MCM-2 is a therapeutic target of Trichostatin A in colon cancer cells. Toxicol Lett. 2013 Jul 31;221(1):23-30. doi: 10.1016/j.toxlet.2013.05.643. Epub 2013 Jun 13.
• [60] Pleiotropic combinatorial transcriptomes of human breast cancer cells exposed to mixtures of dietary phytoestrogens. Food Chem Toxicol. 2009 Apr;47(4):787-95.
• [61] Transcriptome and DNA methylation changes modulated by sulforaphane induce cell cycle arrest, apoptosis, DNA damage, and suppression of proliferation in human liver cancer cells. Food Chem Toxicol. 2020 Feb;136:111047. doi: 10.1016/j.fct.2019.111047. Epub 2019 Dec 12.
• [62] Neurotoxicity and underlying cellular changes of 21 mitochondrial respiratory chain inhibitors. Arch Toxicol. 2021 Feb;95(2):591-615. doi: 10.1007/s00204-020-02970-5. Epub 2021 Jan 29.
• [63] Early gene response in lithium chloride induced apoptosis. Apoptosis. 2005 Jan;10(1):75-90. doi: 10.1007/s10495-005-6063-x.
• [64] Gene expression profiling of human primary astrocytes exposed to manganese chloride indicates selective effects on several functions of the cells. Neurotoxicology. 2007 May;28(3):478-89.
• [65] MS4A3-HSP27 target pathway reveals potential for haematopoietic disorder treatment in alimentary toxic aleukia. Cell Biol Toxicol. 2023 Feb;39(1):201-216. doi: 10.1007/s10565-021-09639-4. Epub 2021 Sep 28.
• [66] Okadaic acid and dinophysis toxin 2 have differential toxicological effects in hepatic cell lines inducing cell cycle arrest, at G0/G1 or G2/M with aberrant mitosis depending on the cell line. Arch Toxicol. 2011 Dec;85(12):1541-50. doi: 10.1007/s00204-011-0702-5. Epub 2011 Apr 22.
• [67] In Vitro Exposure of Human Luteinized Mural Granulosa Cells to Dibutyl Phthalate Affects Global Gene Expression. Toxicol Sci. 2017 Nov 1;160(1):180-188. doi: 10.1093/toxsci/kfx170.
• [68] Gene expression profiling of 30 cancer cell lines predicts resistance towards 11 anticancer drugs at clinically achieved concentrations. Int J Cancer. 2006 Apr 1;118(7):1699-712. doi: 10.1002/ijc.21570.