General Information of Drug Off-Target (DOT) (ID: OTJ02XFL)

DOT Name Outer mitochondrial transmembrane helix translocase (ATAD1)
Synonyms EC 7.4.2.-; ATPase family AAA domain-containing protein 1; hATAD1; Thorase
Gene Name ATAD1
Related Disease
Bladder cancer ( )
Myocardial infarction ( )
Plasmodium vivax malaria ( )
Urinary bladder neoplasm ( )
Acute leukaemia ( )
Acute lymphocytic leukaemia ( )
Anemia ( )
Arthrogryposis ( )
Breast cancer ( )
Breast carcinoma ( )
Coeliac disease ( )
Duchenne muscular dystrophy ( )
Endometrial cancer ( )
Endometrial carcinoma ( )
Familial adenomatous polyposis ( )
Gallbladder cancer ( )
Gastric cancer ( )
Hepatocellular carcinoma ( )
Hereditary nonpolyposis colon cancer ( )
Hyperekplexia 4 ( )
Hyperlipidemia ( )
Hyperlipidemia, familial combined, LPL related ( )
Inclusion body myopathy with Paget disease of bone and frontotemporal dementia type 1 ( )
Lynch syndrome ( )
Nephrotic syndrome ( )
Parkinson disease ( )
Plasma cell myeloma ( )
Polycystic ovarian syndrome ( )
Small lymphocytic lymphoma ( )
Stomach cancer ( )
Ulcerative colitis ( )
Urinary bladder cancer ( )
Amyotrophic lateral sclerosis ( )
Coronary heart disease ( )
Plasmodium falciparum malaria ( )
Hereditary hyperekplexia ( )
Acute myelogenous leukaemia ( )
Cervical cancer ( )
Cervical carcinoma ( )
Colorectal carcinoma ( )
Fabry disease ( )
Myelodysplastic syndrome ( )
Neoplasm ( )
Pancreatic cancer ( )
Rectal carcinoma ( )
Tuberculosis ( )
UniProt ID
ATAD1_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
7UPR; 7UPT
EC Number
7.4.2.-
Pfam ID
PF00004 ; PF17862
Sequence
MVHAEAFSRPLSRNEVVGLIFRLTIFGAVTYFTIKWMVDAIDPTRKQKVEAQKQAEKLMK
QIGVKNVKLSEYEMSIAAHLVDPLNMHVTWSDIAGLDDVITDLKDTVILPIKKKHLFENS
RLLQPPKGVLLYGPPGCGKTLIAKATAKEAGCRFINLQPSTLTDKWYGESQKLAAAVFSL
AIKLQPSIIFIDEIDSFLRNRSSSDHEATAMMKAQFMSLWDGLDTDHSCQVIVMGATNRP
QDLDSAIMRRMPTRFHINQPALKQREAILKLILKNENVDRHVDLLEVAQETDGFSGSDLK
EMCRDAALLCVREYVNSTSEESHDEDEIRPVQQQDLHRAIEKMKKSKDAAFQNVLTHVCL
D
Function
Outer mitochondrial translocase required to remove mislocalized tail-anchored transmembrane proteins on mitochondria. Specifically recognizes and binds tail-anchored transmembrane proteins: acts as a dislocase that mediates the ATP-dependent extraction of mistargeted tail-anchored transmembrane proteins from the mitochondrion outer membrane. Also plays a critical role in regulating the surface expression of AMPA receptors (AMPAR), thereby regulating synaptic plasticity and learning and memory. Required for NMDA-stimulated AMPAR internalization and inhibition of GRIA1 and GRIA2 recycling back to the plasma membrane; these activities are ATPase-dependent.
Reactome Pathway
Class I peroxisomal membrane protein import (R-HSA-9603798 )

Molecular Interaction Atlas (MIA) of This DOT

46 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Bladder cancer DISUHNM0 Definitive Genetic Variation [1]
Myocardial infarction DIS655KI Definitive Genetic Variation [2]
Plasmodium vivax malaria DISPU3H9 Definitive Biomarker [3]
Urinary bladder neoplasm DIS7HACE Definitive Genetic Variation [1]
Acute leukaemia DISDQFDI Strong Genetic Variation [4]
Acute lymphocytic leukaemia DISPX75S Strong Genetic Variation [5]
Anemia DISTVL0C Strong Biomarker [6]
Arthrogryposis DISC81CM Strong Genetic Variation [7]
Breast cancer DIS7DPX1 Strong Genetic Variation [8]
Breast carcinoma DIS2UE88 Strong Genetic Variation [8]
Coeliac disease DISIY60C Strong Genetic Variation [9]
Duchenne muscular dystrophy DISRQ3NV Strong Genetic Variation [10]
Endometrial cancer DISW0LMR Strong Genetic Variation [11]
Endometrial carcinoma DISXR5CY Strong Genetic Variation [11]
Familial adenomatous polyposis DISW53RE Strong Biomarker [12]
Gallbladder cancer DISXJUAF Strong Genetic Variation [13]
Gastric cancer DISXGOUK Strong Genetic Variation [14]
Hepatocellular carcinoma DIS0J828 Strong Genetic Variation [14]
Hereditary nonpolyposis colon cancer DISPA49R Strong Genetic Variation [15]
Hyperekplexia 4 DIS5CD4T Strong Autosomal recessive [16]
Hyperlipidemia DIS61J3S Strong Biomarker [17]
Hyperlipidemia, familial combined, LPL related DISL1CE3 Strong Biomarker [18]
Inclusion body myopathy with Paget disease of bone and frontotemporal dementia type 1 DISHQXXA Strong Biomarker [19]
Lynch syndrome DIS3IW5F Strong Genetic Variation [15]
Nephrotic syndrome DISSPSC2 Strong Biomarker [20]
Parkinson disease DISQVHKL Strong Genetic Variation [21]
Plasma cell myeloma DIS0DFZ0 Strong Genetic Variation [5]
Polycystic ovarian syndrome DISZ2BNG Strong Genetic Variation [22]
Small lymphocytic lymphoma DIS30POX Strong Biomarker [23]
Stomach cancer DISKIJSX Strong Genetic Variation [14]
Ulcerative colitis DIS8K27O Strong Genetic Variation [24]
Urinary bladder cancer DISDV4T7 Strong Genetic Variation [1]
Amyotrophic lateral sclerosis DISF7HVM moderate Genetic Variation [25]
Coronary heart disease DIS5OIP1 moderate Genetic Variation [26]
Plasmodium falciparum malaria DIS3Q9KF moderate Genetic Variation [27]
Hereditary hyperekplexia DIS9YXFE Supportive Autosomal dominant [7]
Acute myelogenous leukaemia DISCSPTN Limited Biomarker [28]
Cervical cancer DISFSHPF Limited Genetic Variation [29]
Cervical carcinoma DIST4S00 Limited Genetic Variation [29]
Colorectal carcinoma DIS5PYL0 Limited Genetic Variation [14]
Fabry disease DISUUQJF Limited Genetic Variation [30]
Myelodysplastic syndrome DISYHNUI Limited Posttranslational Modification [28]
Neoplasm DISZKGEW Limited Genetic Variation [31]
Pancreatic cancer DISJC981 Limited Posttranslational Modification [32]
Rectal carcinoma DIS8FRR7 Limited Genetic Variation [33]
Tuberculosis DIS2YIMD Limited Biomarker [34]
------------------------------------------------------------------------------------
⏷ Show the Full List of 46 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
3 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the methylation of Outer mitochondrial transmembrane helix translocase (ATAD1). [35]
PMID28870136-Compound-52 DMFDERP Patented PMID28870136-Compound-52 decreases the phosphorylation of Outer mitochondrial transmembrane helix translocase (ATAD1). [41]
Coumarin DM0N8ZM Investigative Coumarin decreases the phosphorylation of Outer mitochondrial transmembrane helix translocase (ATAD1). [41]
------------------------------------------------------------------------------------
5 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Ciclosporin DMAZJFX Approved Ciclosporin increases the expression of Outer mitochondrial transmembrane helix translocase (ATAD1). [36]
Ivermectin DMDBX5F Approved Ivermectin decreases the expression of Outer mitochondrial transmembrane helix translocase (ATAD1). [37]
Testosterone DM7HUNW Approved Testosterone decreases the expression of Outer mitochondrial transmembrane helix translocase (ATAD1). [38]
Urethane DM7NSI0 Phase 4 Urethane increases the expression of Outer mitochondrial transmembrane helix translocase (ATAD1). [39]
Leflunomide DMR8ONJ Phase 1 Trial Leflunomide increases the expression of Outer mitochondrial transmembrane helix translocase (ATAD1). [40]
------------------------------------------------------------------------------------

References

1 Genetic polymorphisms of cytochrome P450 CYP1A1 (*2A) and microsomal epoxide hydrolase gene, interactions with tobacco-users, and susceptibility to bladder cancer: a study from North India.Arch Toxicol. 2008 Sep;82(9):633-9. doi: 10.1007/s00204-007-0276-4. Epub 2008 Jan 16.
2 Restriction fragment length polymorphisms in the apolipoprotein B gene in survivors of myocardial infarction.Med Sci Monit. 2000 Sep-Oct;6(5):882-6.
3 Study of the genetic discrimination between imported and autochthonous cases of malaria in South Korea.J Travel Med. 2011 Jan-Feb;18(1):63-6. doi: 10.1111/j.1708-8305.2010.00473.x. Epub 2010 Dec 16.
4 Meta-analysis of cytochrome P4501A1 MspI gene polymorphism and childhood acute leukemia.Biomed Environ Sci. 2011 Dec;24(6):683-7. doi: 10.3967/0895-3988.2011.06.014.
5 Genomic hypomethylation in human chronic lymphocytic leukemia.Blood. 1992 Oct 15;80(8):2074-80.
6 Genetic linkage of autologous T cell epitopes in a chimeric recombinant construct improves anti-parasite and anti-disease protective effect of a malaria vaccine candidate.Vaccine. 2010 Mar 19;28(14):2580-92. doi: 10.1016/j.vaccine.2010.01.019. Epub 2010 Jan 22.
7 A homozygous ATAD1 mutation impairs postsynaptic AMPA receptor trafficking and causes a lethal encephalopathy. Brain. 2018 Mar 1;141(3):651-661. doi: 10.1093/brain/awx377.
8 Cytochrome P4501A1 polymorphism as a susceptibility factor for breast cancer in postmenopausal Chinese women in Taiwan.Br J Cancer. 1999 Aug;80(11):1838-43. doi: 10.1038/sj.bjc.6690608.
9 HLA-DP and coeliac disease: family and population studies.Gut. 1990 Jun;31(6):663-7. doi: 10.1136/gut.31.6.663.
10 Assignment of the locus order DXS28-DXS67-DMD as a spin-off from diagnostic DNA marker analysis in a family with Duchenne muscular dystrophy.Clin Genet. 1987 Mar;31(3):192-7. doi: 10.1111/j.1399-0004.1987.tb02794.x.
11 Cytochrome P450 1A1 gene polymorphisms and endometrial cancer risk: a meta-analysis.Int J Gynecol Cancer. 2011 Feb;21(2):323-31. doi: 10.1097/IGC.0b013e31820575c0.
12 Meningiomas exhibit loss of heterozygosity of the APC gene.J Neurooncol. 2008 Mar;87(1):63-70. doi: 10.1007/s11060-007-9500-6. Epub 2007 Dec 8.
13 Association of CYP1A1 Msp1 polymorphism with tobacco-related risk of gallbladder cancer in a north Indian population.Eur J Cancer Prev. 2008 Apr;17(2):77-81. doi: 10.1097/CEJ.0b013e3282b6fdd2.
14 Meta-analysis of association studies of CYP1A1 genetic polymorphisms with digestive tract cancer susceptibility in Chinese.Asian Pac J Cancer Prev. 2014;15(11):4689-95. doi: 10.7314/apjcp.2014.15.11.4689.
15 Genetic variation in genes for the xenobiotic-metabolizing enzymes CYP1A1, EPHX1, GSTM1, GSTT1, and GSTP1 and susceptibility to colorectal cancer in Lynch syndrome.Cancer Epidemiol Biomarkers Prev. 2008 Sep;17(9):2393-401. doi: 10.1158/1055-9965.EPI-08-0326.
16 Precision therapy for a new disorder of AMPA receptor recycling due to mutations in ATAD1. Neurol Genet. 2017 Feb 1;3(1):e130. doi: 10.1212/NXG.0000000000000130. eCollection 2017 Feb.
17 Catabolic rate of low density lipoprotein is influenced by variation in the apolipoprotein B gene.J Clin Invest. 1988 Sep;82(3):797-802. doi: 10.1172/JCI113681.
18 Apolipoprotein B-100 Hopkins (arginine4019----tryptophan). A new apolipoprotein B-100 variant in a family with premature atherosclerosis and hyperapobetalipoproteinemia.JAMA. 1989 Oct 13;262(14):1980-8. doi: 10.1001/jama.262.14.1980.
19 Influence of HLA-DRB-1 alleles on the production of antibody against CSP, MSP-1, AMA-1, and DBP in Brazilian individuals naturally infected with Plasmodium vivax.Acta Trop. 2012 Feb;121(2):152-5. doi: 10.1016/j.actatropica.2011.10.009. Epub 2011 Nov 4.
20 Association of polymorphisms at restriction enzyme recognition sites of apolipoprotein B and E gene with dyslipidemia in children undergoing primary nephrotic syndrome.Mol Biol Rep. 2009 May;36(5):1015-21. doi: 10.1007/s11033-008-9275-7. Epub 2008 May 30.
21 Polymorphisms of dopamine receptor and transporter genes and hallucinations in Parkinson's disease.Neurosci Lett. 2004 Jan 30;355(3):193-6. doi: 10.1016/j.neulet.2003.11.006.
22 CYP1A1, GSTM1 and GSTT1 genetic polymorphism is associated with susceptibility to polycystic ovaries in South Indian women.Reprod Biomed Online. 2004 Aug;9(2):194-200. doi: 10.1016/s1472-6483(10)62129-3.
23 bcl-2 gene hypomethylation and high-level expression in B-cell chronic lymphocytic leukemia.Blood. 1993 Sep 15;82(6):1820-8.
24 P53 germ line haplotypes associated with increased risk for colorectal cancer.Carcinogenesis. 1995 Jul;16(7):1461-4. doi: 10.1093/carcin/16.7.1461.
25 Amyotrophic lateral sclerosis, lead, and genetic susceptibility: polymorphisms in the delta-aminolevulinic acid dehydratase and vitamin D receptor genes.Environ Health Perspect. 2003 Aug;111(10):1335-9. doi: 10.1289/ehp.6109.
26 Cholesterol ester transfer protein, apolipoprotein E and lipoprotein lipase genotypes in patients with coronary artery disease in the Turkish population.Clin Genet. 2003 Sep;64(3):228-34. doi: 10.1034/j.1399-0004.2003.00137.x.
27 MAD 20 alleles of merozoite surface protein-1 (msp-1) are associated with severe Plasmodium falciparum malaria in Pakistan.J Microbiol Immunol Infect. 2015 Apr;48(2):213-8. doi: 10.1016/j.jmii.2014.01.004. Epub 2014 Mar 27.
28 Semi-quantitative study of calcitonin gene methylation in myelodysplastic syndrome.Chin Med J (Engl). 1998 Aug;111(8):690-3.
29 The risk of developing cervical cancer in Mexican women is associated to CYP1A1 MspI polymorphism.Eur J Cancer. 2007 Jul;43(10):1590-5. doi: 10.1016/j.ejca.2007.03.025. Epub 2007 May 18.
30 Fabry disease: six gene rearrangements and an exonic point mutation in the alpha-galactosidase gene.J Clin Invest. 1989 Apr;83(4):1390-9. doi: 10.1172/JCI114027.
31 Role of functional polymorphisms of P53 and P73 genes with the risk of prostate cancer in a case-control study from Northern India.Arch Med Res. 2011 Feb;42(2):122-7. doi: 10.1016/j.arcmed.2011.03.001.
32 Significance of MUC2 gene methylation detection in pancreatic cancer diagnosis.Pancreatology. 2019 Dec;19(8):1049-1053. doi: 10.1016/j.pan.2019.09.012. Epub 2019 Sep 27.
33 CYP1A1, cigarette smoking, and colon and rectal cancer.Am J Epidemiol. 2004 Nov 1;160(9):842-52. doi: 10.1093/aje/kwh298.
34 Contribution of AGC to ACC and other mutations at codon 315 of the katG gene in isoniazid-resistant Mycobacterium tuberculosis isolates from the Middle East.Int J Antimicrob Agents. 2004 May;23(5):473-9. doi: 10.1016/j.ijantimicag.2003.10.004.
35 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
36 Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
37 Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
38 The exosome-like vesicles derived from androgen exposed-prostate stromal cells promote epithelial cells proliferation and epithelial-mesenchymal transition. Toxicol Appl Pharmacol. 2021 Jan 15;411:115384. doi: 10.1016/j.taap.2020.115384. Epub 2020 Dec 25.
39 Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
40 Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
41 Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.