Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTL3L14B)

• DOT Name: Glycogen synthase kinase-3 beta (GSK3B)
• Synonyms: GSK-3 beta; EC 2.7.11.26; Serine/threonine-protein kinase GSK3B; EC 2.7.11.1
• Gene Name: GSK3B
• UniProt ID: GSK3B_HUMAN
• PDB ID: 1GNG ; 1H8F ; 1I09 ; 1J1B ; 1J1C ; 1O6K ; 1O6L ; 1O9U ; 1PYX ; 1Q3D ; 1Q3W ; 1Q41 ; 1Q4L ; 1Q5K ; 1R0E ; 1UV5 ; 2JDO ; 2JDR ; 2JLD ; 2O5K ; 2OW3 ; 2UW9 ; 2X39 ; 2XH5 ; 3CQU ; 3CQW ; 3DU8 ; 3E87 ; 3E88 ; 3E8D ; 3F7Z ; 3F88 ; 3GB2 ; 3I4B ; 3L1S ; 3M1S ; 3MV5 ; 3OW4 ; 3PUP ; 3Q3B ; 3QKK ; 3SAY ; 3SD0 ; 3ZDI ; 3ZRK ; 3ZRL ; 3ZRM ; 4ACC ; 4ACD ; 4ACG ; 4ACH ; 4AFJ ; 4B7T ; 4DIT ; 4EKK ; 4IQ6 ; 4J1R ; 4J71 ; 4NM0 ; 4NM3 ; 4NM5 ; 4NM7 ; 4PTC ; 4PTE ; 4PTG ; 5F94 ; 5F95 ; 5HLN ; 5HLP ; 5K5N ; 5KPK ; 5KPL ; 5KPM ; 5OY4 ; 5T31 ; 6B8J ; 6BUU ; 6GJO ; 6GN1 ; 6H0U ; 6HK3 ; 6HK4 ; 6HK7 ; 6NPZ ; 6TCU ; 6V6L ; 6Y9R ; 6Y9S ; 7B6F ; 7OY5 ; 7SXH ; 7SXJ ; 7U2Z ; 7U31 ; 7U33 ; 7U36 ; 7Z1F ; 7Z1G ; 8AUZ ; 8AV1 ; 8DJC ; 8DJD ; 8DJE ; 8FF8
• EC Number: 2.7.11.1; 2.7.11.26
• Pfam ID: PF00069
• Sequence:
  MSGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTK
  VIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSG
  EKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHR
  DIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDV
  WSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHP
  WTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALF
  NFTTQELSSNPPLATILIPPHARIQAAASTPTNATAASDANTGDRGQTNNAASASASNST
• Function: Constitutively active protein kinase that acts as a negative regulator in the hormonal control of glucose homeostasis, Wnt signaling and regulation of transcription factors and microtubules, by phosphorylating and inactivating glycogen synthase (GYS1 or GYS2), EIF2B, CTNNB1/beta-catenin, APC, AXIN1, DPYSL2/CRMP2, JUN, NFATC1/NFATC, MAPT/TAU and MACF1. Requires primed phosphorylation of the majority of its substrates. In skeletal muscle, contributes to insulin regulation of glycogen synthesis by phosphorylating and inhibiting GYS1 activity and hence glycogen synthesis. May also mediate the development of insulin resistance by regulating activation of transcription factors. Regulates protein synthesis by controlling the activity of initiation factor 2B (EIF2BE/EIF2B5) in the same manner as glycogen synthase. In Wnt signaling, GSK3B forms a multimeric complex with APC, AXIN1 and CTNNB1/beta-catenin and phosphorylates the N-terminus of CTNNB1 leading to its degradation mediated by ubiquitin/proteasomes. Phosphorylates JUN at sites proximal to its DNA-binding domain, thereby reducing its affinity for DNA. Phosphorylates NFATC1/NFATC on conserved serine residues promoting NFATC1/NFATC nuclear export, shutting off NFATC1/NFATC gene regulation, and thereby opposing the action of calcineurin. Phosphorylates MAPT/TAU on 'Thr-548', decreasing significantly MAPT/TAU ability to bind and stabilize microtubules. MAPT/TAU is the principal component of neurofibrillary tangles in Alzheimer disease. Plays an important role in ERBB2-dependent stabilization of microtubules at the cell cortex. Phosphorylates MACF1, inhibiting its binding to microtubules which is critical for its role in bulge stem cell migration and skin wound repair. Probably regulates NF-kappa-B (NFKB1) at the transcriptional level and is required for the NF-kappa-B-mediated anti-apoptotic response to TNF-alpha (TNF/TNFA). Negatively regulates replication in pancreatic beta-cells, resulting in apoptosis, loss of beta-cells and diabetes. Through phosphorylation of the anti-apoptotic protein MCL1, may control cell apoptosis in response to growth factors deprivation. Phosphorylates MUC1 in breast cancer cells, decreasing the interaction of MUC1 with CTNNB1/beta-catenin. Is necessary for the establishment of neuronal polarity and axon outgrowth. Phosphorylates MARK2, leading to inhibition of its activity. Phosphorylates SIK1 at 'Thr-182', leading to sustainment of its activity. Phosphorylates ZC3HAV1 which enhances its antiviral activity. Phosphorylates SNAI1, leading to its BTRC-triggered ubiquitination and proteasomal degradation. Phosphorylates SFPQ at 'Thr-687' upon T-cell activation. Phosphorylates NR1D1 st 'Ser-55' and 'Ser-59' and stabilizes it by protecting it from proteasomal degradation. Regulates the circadian clock via phosphorylation of the major clock components including BMAL1, CLOCK and PER2. Phosphorylates FBXL2 at 'Thr-404' and primes it for ubiquitination by the SCF(FBXO3) complex and proteasomal degradation. Phosphorylates CLOCK AT 'Ser-427' and targets it for proteasomal degradation. Phosphorylates BMAL1 at 'Ser-17' and 'Ser-21' and primes it for ubiquitination and proteasomal degradation. Phosphorylates OGT at 'Ser-3' or 'Ser-4' which positively regulates its activity. Phosphorylates MYCN in neuroblastoma cells which may promote its degradation. Regulates the circadian rhythmicity of hippocampal long-term potentiation and BMAL1 and PER2 expression. Acts as a regulator of autophagy by mediating phosphorylation of KAT5/TIP60 under starvation conditions, activating KAT5/TIP60 acetyltransferase activity and promoting acetylation of key autophagy regulators, such as ULK1 and RUBCNL/Pacer. Negatively regulates extrinsic apoptotic signaling pathway via death domain receptors. Promotes the formation of an anti-apoptotic complex, made of DDX3X, BRIC2 and GSK3B, at death receptors, including TNFRSF10B. The anti-apoptotic function is most effective with weak apoptotic signals and can be overcome by stronger stimulation. Phosphorylates E2F1, promoting the interaction between E2F1 and USP11, stabilizing E2F1 and promoting its activity. Phosphorylates mTORC2 complex component RICTOR at 'Thr-1695' which facilitates FBXW7-mediated ubiquitination and subsequent degradation of RICTOR. Phosphorylates FXR1, promoting FXR1 ubiquitination by the SCF(FBXO4) complex and FXR1 degradation by the proteasome. Phosphorylates interleukin-22 receptor subunit IL22RA1, preventing its proteasomal degradation.
• Tissue Specificity: Expressed in testis, thymus, prostate and ovary and weakly expressed in lung, brain and kidney. Colocalizes with EIF2AK2/PKR and TAU in the Alzheimer disease (AD) brain.
• KEGG Pathway:
  EGFR tyrosine ki.se inhibitor resistance (hsa01521)
  ErbB sig.ling pathway (hsa04012)
  Chemokine sig.ling pathway (hsa04062)
  Cell cycle (hsa04110)
  mTOR sig.ling pathway (hsa04150)
  PI3K-Akt sig.ling pathway (hsa04151)
  Wnt sig.ling pathway (hsa04310)
  Hedgehog sig.ling pathway (hsa04340)
  Axon guidance (hsa04360)
  Hippo sig.ling pathway (hsa04390)
  Focal adhesion (hsa04510)
  Sig.ling pathways regulating pluripotency of stem cells (hsa04550)
  IL-17 sig.ling pathway (hsa04657)
  T cell receptor sig.ling pathway (hsa04660)
  B cell receptor sig.ling pathway (hsa04662)
  Neurotrophin sig.ling pathway (hsa04722)
  Dopaminergic sy.pse (hsa04728)
  Insulin sig.ling pathway (hsa04910)
  Melanogenesis (hsa04916)
  Prolactin sig.ling pathway (hsa04917)
  Thyroid hormone sig.ling pathway (hsa04919)
  Insulin resistance (hsa04931)
  Non-alcoholic fatty liver disease (hsa04932)
  Cushing syndrome (hsa04934)
  Growth hormone synthesis, secretion and action (hsa04935)
  Alcoholic liver disease (hsa04936)
  Alzheimer disease (hsa05010)
  Prion disease (hsa05020)
  Pathways of neurodegeneration - multiple diseases (hsa05022)
  Shigellosis (hsa05131)
  Yersinia infection (hsa05135)
  Hepatitis C (hsa05160)
  Measles (hsa05162)
  Human cytomegalovirus infection (hsa05163)
  Human papillomavirus infection (hsa05165)
  Kaposi sarcoma-associated herpesvirus infection (hsa05167)
  Pathways in cancer (hsa05200)
  Colorectal cancer (hsa05210)
  Endometrial cancer (hsa05213)
  Prostate cancer (hsa05215)
  Basal cell carcinoma (hsa05217)
  Breast cancer (hsa05224)
  Hepatocellular carcinoma (hsa05225)
  Gastric cancer (hsa05226)
  Diabetic cardiomyopathy (hsa05415)
  Lipid and atherosclerosis (hsa05417)
• Reactome Pathway:
  Beta-catenin phosphorylation cascade (R-HSA-196299)
  AKT phosphorylates targets in the cytosol (R-HSA-198323)
  Regulation of HSF1-mediated heat shock response (R-HSA-3371453)
  CRMPs in Sema3A signaling (R-HSA-399956)
  Disassembly of the destruction complex and recruitment of AXIN to the membrane (R-HSA-4641262)
  B-WICH complex positively regulates rRNA expression (R-HSA-5250924)
  Signaling by GSK3beta mutants (R-HSA-5339716)
  CTNNB1 S33 mutants aren't phosphorylated (R-HSA-5358747)
  CTNNB1 S37 mutants aren't phosphorylated (R-HSA-5358749)
  CTNNB1 S45 mutants aren't phosphorylated (R-HSA-5358751)
  CTNNB1 T41 mutants aren't phosphorylated (R-HSA-5358752)
  APC truncation mutants have impaired AXIN binding (R-HSA-5467337)
  AXIN missense mutants destabilize the destruction complex (R-HSA-5467340)
  Truncations of AMER1 destabilize the destruction complex (R-HSA-5467348)
  Degradation of GLI2 by the proteasome (R-HSA-5610783)
  GLI3 is processed to GLI3R by the proteasome (R-HSA-5610785)
  Constitutive Signaling by AKT1 E17K in Cancer (R-HSA-5674400)
  Ubiquitin-dependent degradation of Cyclin D (R-HSA-75815)
  Regulation of RUNX2 expression and activity (R-HSA-8939902)
  Maturation of nucleoprotein (R-HSA-9683610)
  Maturation of nucleoprotein (R-HSA-9694631)
  GSK3B and BTRC (R-HSA-9762114)
  Degradation of beta-catenin by the destruction complex (R-HSA-195253)

Molecular Interaction Atlas (MIA) of This DOT

This DOT Affected the Regulation of Drug Effects of 2 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Glutathione	DMAHMT9	Approved	Glycogen synthase kinase-3 beta (GSK3B) increases the abundance of Glutathione.	[52]
Nicotinamide-Adenine-Dinucleotide	DM9LRKB	Investigative	Glycogen synthase kinase-3 beta (GSK3B) increases the abundance of Nicotinamide-Adenine-Dinucleotide.	[52]

49 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Glycogen synthase kinase-3 beta (GSK3B).	[1]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Glycogen synthase kinase-3 beta (GSK3B).	[2]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Glycogen synthase kinase-3 beta (GSK3B).	[3]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of Glycogen synthase kinase-3 beta (GSK3B).	[5]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of Glycogen synthase kinase-3 beta (GSK3B).	[6]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Glycogen synthase kinase-3 beta (GSK3B).	[8]
Arsenic	DMTL2Y1	Approved	Arsenic decreases the expression of Glycogen synthase kinase-3 beta (GSK3B).	[9]
Quercetin	DM3NC4M	Approved	Quercetin decreases the expression of Glycogen synthase kinase-3 beta (GSK3B).	[10]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide increases the expression of Glycogen synthase kinase-3 beta (GSK3B).	[12]
Testosterone	DM7HUNW	Approved	Testosterone increases the expression of Glycogen synthase kinase-3 beta (GSK3B).	[14]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of Glycogen synthase kinase-3 beta (GSK3B).	[15]
Marinol	DM70IK5	Approved	Marinol increases the expression of Glycogen synthase kinase-3 beta (GSK3B).	[16]
Selenium	DM25CGV	Approved	Selenium decreases the expression of Glycogen synthase kinase-3 beta (GSK3B).	[17]
Menadione	DMSJDTY	Approved	Menadione increases the expression of Glycogen synthase kinase-3 beta (GSK3B).	[19]
Niclosamide	DMJAGXQ	Approved	Niclosamide decreases the expression of Glycogen synthase kinase-3 beta (GSK3B).	[20]
Cannabidiol	DM0659E	Approved	Cannabidiol decreases the expression of Glycogen synthase kinase-3 beta (GSK3B).	[21]
Troglitazone	DM3VFPD	Approved	Troglitazone decreases the activity of Glycogen synthase kinase-3 beta (GSK3B).	[22]
Aspirin	DM672AH	Approved	Aspirin decreases the activity of Glycogen synthase kinase-3 beta (GSK3B).	[25]
Testosterone enanthate	DMB6871	Approved	Testosterone enanthate affects the expression of Glycogen synthase kinase-3 beta (GSK3B).	[26]
Diclofenac	DMPIHLS	Approved	Diclofenac affects the expression of Glycogen synthase kinase-3 beta (GSK3B).	[15]
Simvastatin	DM30SGU	Approved	Simvastatin increases the expression of Glycogen synthase kinase-3 beta (GSK3B).	[30]
Pioglitazone	DMKJ485	Approved	Pioglitazone increases the expression of Glycogen synthase kinase-3 beta (GSK3B).	[34]
Gefitinib	DM15F0X	Approved	Gefitinib decreases the expression of Glycogen synthase kinase-3 beta (GSK3B).	[36]
Dinoprostone	DMTYOPD	Approved	Dinoprostone decreases the expression of Glycogen synthase kinase-3 beta (GSK3B).	[38]
Olanzapine	DMPFN6Y	Approved	Olanzapine decreases the expression of Glycogen synthase kinase-3 beta (GSK3B).	[40]
Adenosine	DMM2NSK	Approved	Adenosine increases the expression of Glycogen synthase kinase-3 beta (GSK3B).	[42]
Urethane	DM7NSI0	Phase 4	Urethane increases the expression of Glycogen synthase kinase-3 beta (GSK3B).	[46]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 decreases the expression of Glycogen synthase kinase-3 beta (GSK3B).	[1]
Resveratrol	DM3RWXL	Phase 3	Resveratrol decreases the activity of Glycogen synthase kinase-3 beta (GSK3B).	[48]
Tamibarotene	DM3G74J	Phase 3	Tamibarotene affects the expression of Glycogen synthase kinase-3 beta (GSK3B).	[49]
Curcumin	DMQPH29	Phase 3	Curcumin decreases the expression of Glycogen synthase kinase-3 beta (GSK3B).	[51]
Napabucasin	DMDZ6Q3	Phase 3	Napabucasin decreases the expression of Glycogen synthase kinase-3 beta (GSK3B).	[54]
Tocopherol	DMBIJZ6	Phase 2	Tocopherol decreases the expression of Glycogen synthase kinase-3 beta (GSK3B).	[17]
DNCB	DMDTVYC	Phase 2	DNCB increases the expression of Glycogen synthase kinase-3 beta (GSK3B).	[59]
Tanespimycin	DMNLQHK	Phase 2	Tanespimycin decreases the expression of Glycogen synthase kinase-3 beta (GSK3B).	[61]
Tetrandrine	DMAOJBX	Phase 1	Tetrandrine decreases the expression of Glycogen synthase kinase-3 beta (GSK3B).	[68]
Eugenol	DM7US1H	Patented	Eugenol increases the expression of Glycogen synthase kinase-3 beta (GSK3B).	[59]
PMID28460551-Compound-3	DMA1FRM	Patented	PMID28460551-Compound-3 decreases the activity of Glycogen synthase kinase-3 beta (GSK3B).	[75]
PMID26560530-Compound-8	DMN6TG7	Patented	PMID26560530-Compound-8 decreases the expression of Glycogen synthase kinase-3 beta (GSK3B).	[76]
MG-132	DMKA2YS	Preclinical	MG-132 decreases the expression of Glycogen synthase kinase-3 beta (GSK3B).	[77]
Nimesulide	DMR1NMD	Terminated	Nimesulide decreases the activity of Glycogen synthase kinase-3 beta (GSK3B).	[79]
SB 203580	DMAET6F	Terminated	SB 203580 decreases the activity of Glycogen synthase kinase-3 beta (GSK3B).	[75]
Calphostin C	DM9X2D0	Terminated	Calphostin C increases the expression of Glycogen synthase kinase-3 beta (GSK3B).	[80]
Dizocilpine	DMMGYXR	Terminated	Dizocilpine increases the expression of Glycogen synthase kinase-3 beta (GSK3B).	[40]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde increases the expression of Glycogen synthase kinase-3 beta (GSK3B).	[82]
Paraquat	DMR8O3X	Investigative	Paraquat decreases the expression of Glycogen synthase kinase-3 beta (GSK3B).	[86]
4-hydroxy-2-nonenal	DM2LJFZ	Investigative	4-hydroxy-2-nonenal decreases the expression of Glycogen synthase kinase-3 beta (GSK3B).	[87]
Lithium chloride	DMHYLQ2	Investigative	Lithium chloride decreases the activity of Glycogen synthase kinase-3 beta (GSK3B).	[88]
Okadaic acid	DM47CO1	Investigative	Okadaic acid increases the expression of Glycogen synthase kinase-3 beta (GSK3B).	[89]

51 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Doxorubicin	DMVP5YE	Approved	Doxorubicin increases the phosphorylation of Glycogen synthase kinase-3 beta (GSK3B).	[4]
Estradiol	DMUNTE3	Approved	Estradiol increases the phosphorylation of Glycogen synthase kinase-3 beta (GSK3B).	[7]
Temozolomide	DMKECZD	Approved	Temozolomide increases the phosphorylation of Glycogen synthase kinase-3 beta (GSK3B).	[11]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide decreases the phosphorylation of Glycogen synthase kinase-3 beta (GSK3B).	[13]
Progesterone	DMUY35B	Approved	Progesterone increases the phosphorylation of Glycogen synthase kinase-3 beta (GSK3B).	[18]
Rosiglitazone	DMILWZR	Approved	Rosiglitazone increases the phosphorylation of Glycogen synthase kinase-3 beta (GSK3B).	[23]
Ethanol	DMDRQZU	Approved	Ethanol increases the phosphorylation of Glycogen synthase kinase-3 beta (GSK3B).	[24]
Paclitaxel	DMLB81S	Approved	Paclitaxel increases the phosphorylation of Glycogen synthase kinase-3 beta (GSK3B).	[27]
Clozapine	DMFC71L	Approved	Clozapine increases the phosphorylation of Glycogen synthase kinase-3 beta (GSK3B).	[28]
Mitomycin	DMH0ZJE	Approved	Mitomycin increases the phosphorylation of Glycogen synthase kinase-3 beta (GSK3B).	[29]
Gemcitabine	DMSE3I7	Approved	Gemcitabine increases the phosphorylation of Glycogen synthase kinase-3 beta (GSK3B).	[31]
Sulindac	DM2QHZU	Approved	Sulindac decreases the phosphorylation of Glycogen synthase kinase-3 beta (GSK3B).	[32]
Methamphetamine	DMPM4SK	Approved	Methamphetamine affects the phosphorylation of Glycogen synthase kinase-3 beta (GSK3B).	[33]
Sorafenib	DMS8IFC	Approved	Sorafenib increases the phosphorylation of Glycogen synthase kinase-3 beta (GSK3B).	[35]
Imatinib	DM7RJXL	Approved	Imatinib increases the phosphorylation of Glycogen synthase kinase-3 beta (GSK3B).	[37]
Lovastatin	DM9OZWQ	Approved	Lovastatin decreases the phosphorylation of Glycogen synthase kinase-3 beta (GSK3B).	[39]
Glucosamine	DM4ZLFD	Approved	Glucosamine decreases the phosphorylation of Glycogen synthase kinase-3 beta (GSK3B).	[41]
Tacrolimus	DMZ7XNQ	Approved	Tacrolimus increases the phosphorylation of Glycogen synthase kinase-3 beta (GSK3B).	[43]
Bleomycin	DMNER5S	Approved	Bleomycin increases the phosphorylation of Glycogen synthase kinase-3 beta (GSK3B).	[44]
Phloroglucinol	DMUKMC8	Approved	Phloroglucinol decreases the phosphorylation of Glycogen synthase kinase-3 beta (GSK3B).	[45]
Berberine	DMC5Q8X	Phase 4	Berberine increases the phosphorylation of Glycogen synthase kinase-3 beta (GSK3B).	[47]
Epigallocatechin gallate	DMCGWBJ	Phase 3	Epigallocatechin gallate increases the phosphorylation of Glycogen synthase kinase-3 beta (GSK3B).	[50]
Fenretinide	DMRD5SP	Phase 3	Fenretinide increases the phosphorylation of Glycogen synthase kinase-3 beta (GSK3B).	[52]
HMPL-004	DM29XGY	Phase 3	HMPL-004 decreases the phosphorylation of Glycogen synthase kinase-3 beta (GSK3B).	[53]
Bardoxolone methyl	DMODA2X	Phase 3	Bardoxolone methyl increases the phosphorylation of Glycogen synthase kinase-3 beta (GSK3B).	[52]
Dexanabinol	DMRH291	Phase 3	Dexanabinol decreases the phosphorylation of Glycogen synthase kinase-3 beta (GSK3B).	[55]
Amiodarone	DMUTEX3	Phase 2/3 Trial	Amiodarone decreases the phosphorylation of Glycogen synthase kinase-3 beta (GSK3B).	[56]
Thymoquinone	DMVDTR2	Phase 2/3	Thymoquinone decreases the phosphorylation of Glycogen synthase kinase-3 beta (GSK3B).	[57]
Belinostat	DM6OC53	Phase 2	Belinostat increases the phosphorylation of Glycogen synthase kinase-3 beta (GSK3B).	[58]
GSK2110183	DMZHB37	Phase 2	GSK2110183 decreases the phosphorylation of Glycogen synthase kinase-3 beta (GSK3B).	[60]
PEITC	DMOMN31	Phase 2	PEITC increases the phosphorylation of Glycogen synthase kinase-3 beta (GSK3B).	[52]
ANW-32821	DMMJOZD	Phase 2	ANW-32821 increases the phosphorylation of Glycogen synthase kinase-3 beta (GSK3B).	[62]
BAICALEIN	DM4C7E6	Phase 2	BAICALEIN decreases the phosphorylation of Glycogen synthase kinase-3 beta (GSK3B).	[63]
GDC0941	DM1YAK6	Phase 2	GDC0941 decreases the phosphorylation of Glycogen synthase kinase-3 beta (GSK3B).	[64]
GSK2141795	DMSHE70	Phase 2	GSK2141795 decreases the phosphorylation of Glycogen synthase kinase-3 beta (GSK3B).	[65]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the phosphorylation of Glycogen synthase kinase-3 beta (GSK3B).	[66]
LY294002	DMY1AFS	Phase 1	LY294002 decreases the phosphorylation of Glycogen synthase kinase-3 beta (GSK3B).	[67]
BETULINIC ACID	DMBUI2A	Phase 1	BETULINIC ACID increases the phosphorylation of Glycogen synthase kinase-3 beta (GSK3B).	[69]
Adaphostin	DM16QSG	Phase 1	Adaphostin decreases the phosphorylation of Glycogen synthase kinase-3 beta (GSK3B).	[70]
GSK690693	DMRBVHE	Phase 1	GSK690693 decreases the phosphorylation of Glycogen synthase kinase-3 beta (GSK3B).	[71]
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 increases the phosphorylation of Glycogen synthase kinase-3 beta (GSK3B).	[72]
PMID26394986-Compound-22	DM43Z1G	Patented	PMID26394986-Compound-22 decreases the phosphorylation of Glycogen synthase kinase-3 beta (GSK3B).	[73]
CHIR-99021	DMB8MNU	Patented	CHIR-99021 affects the phosphorylation of Glycogen synthase kinase-3 beta (GSK3B).	[74]
Celastrol	DMWQIJX	Preclinical	Celastrol decreases the phosphorylation of Glycogen synthase kinase-3 beta (GSK3B).	[78]
PJ34	DMXO6YH	Preclinical	PJ34 increases the phosphorylation of Glycogen synthase kinase-3 beta (GSK3B).	[27]
Wortmannin	DM8EVK5	Terminated	Wortmannin decreases the phosphorylation of Glycogen synthase kinase-3 beta (GSK3B).	[61]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the methylation of Glycogen synthase kinase-3 beta (GSK3B).	[81]
Coumarin	DM0N8ZM	Investigative	Coumarin increases the phosphorylation of Glycogen synthase kinase-3 beta (GSK3B).	[83]
Deguelin	DMXT7WG	Investigative	Deguelin decreases the phosphorylation of Glycogen synthase kinase-3 beta (GSK3B).	[84]
3R14S-OCHRATOXIN A	DM2KEW6	Investigative	3R14S-OCHRATOXIN A increases the phosphorylation of Glycogen synthase kinase-3 beta (GSK3B).	[85]
D-glucose	DMMG2TO	Investigative	D-glucose decreases the phosphorylation of Glycogen synthase kinase-3 beta (GSK3B).	[47]

References

• [1] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [2] Cyclosporine A--induced oxidative stress in human renal mesangial cells: a role for ERK 1/2 MAPK signaling. Toxicol Sci. 2012 Mar;126(1):101-13.
• [3] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [4] Selenium sensitizes MCF-7 breast cancer cells to doxorubicin-induced apoptosis through modulation of phospho-Akt and its downstream substrates. Mol Cancer Ther. 2007 Mar;6(3):1031-8. doi: 10.1158/1535-7163.MCT-06-0643. Epub 2007 Mar 5.
• [5] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [6] Low doses of cisplatin induce gene alterations, cell cycle arrest, and apoptosis in human promyelocytic leukemia cells. Biomark Insights. 2016 Aug 24;11:113-21.
• [7] Glycogen synthase kinase-3 interacts with and phosphorylates estrogen receptor alpha and is involved in the regulation of receptor activity. J Biol Chem. 2005 Sep 23;280(38):33006-14. doi: 10.1074/jbc.M506758200. Epub 2005 Aug 1.
• [8] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [9] Role of microRNAs in senescence and its contribution to peripheral neuropathy in the arsenic exposed population of West Bengal, India. Environ Pollut. 2018 Feb;233:596-603. doi: 10.1016/j.envpol.2017.09.063. Epub 2017 Nov 5.
• [10] Quercetin potentiates apoptosis by inhibiting nuclear factor-kappaB signaling in H460 lung cancer cells. Biol Pharm Bull. 2013;36(6):944-51. doi: 10.1248/bpb.b12-01004.
• [11] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [12] Chronic occupational exposure to arsenic induces carcinogenic gene signaling networks and neoplastic transformation in human lung epithelial cells. Toxicol Appl Pharmacol. 2012 Jun 1;261(2):204-16.
• [13] The protective effects of liraglutide on AD-like neurodegeneration induced by oxidative stress in human neuroblastoma SH-SY5Y cells. Chem Biol Interact. 2019 Sep 1;310:108688. doi: 10.1016/j.cbi.2019.06.001. Epub 2019 Jun 4.
• [14] A pilot study on the transcriptional response of androgen- and insulin-related genes in peripheral blood mononuclear cells induced by testosterone administration in hypogonadal men. J Biol Regul Homeost Agents. 2011 Apr-Jun;25(2):291-4.
• [15] Drug-induced endoplasmic reticulum and oxidative stress responses independently sensitize toward TNF-mediated hepatotoxicity. Toxicol Sci. 2014 Jul;140(1):144-59. doi: 10.1093/toxsci/kfu072. Epub 2014 Apr 20.
• [16] THC exposure of human iPSC neurons impacts genes associated with neuropsychiatric disorders. Transl Psychiatry. 2018 Apr 25;8(1):89. doi: 10.1038/s41398-018-0137-3.
• [17] Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
• [18] Expression of endometrial glycogen synthase kinase-3beta protein throughout the menstrual cycle and its regulation by progesterone. Mol Hum Reprod. 2006 Sep;12(9):543-9. doi: 10.1093/molehr/gal065. Epub 2006 Aug 1.
• [19] Vitamin K3 (menadione) suppresses epithelial-mesenchymal-transition and Wnt signaling pathway in human colorectal cancer cells. Chem Biol Interact. 2019 Aug 25;309:108725. doi: 10.1016/j.cbi.2019.108725. Epub 2019 Jun 22.
• [20] Growth inhibition of ovarian tumor-initiating cells by niclosamide. Mol Cancer Ther. 2012 Aug;11(8):1703-12.
• [21] Cannabidiol Modulates the Expression of Alzheimer's Disease-Related Genes in Mesenchymal Stem Cells. Int J Mol Sci. 2016 Dec 23;18(1):26. doi: 10.3390/ijms18010026.
• [22] Suppression of NF-kappaB and GSK-3beta is involved in colon cancer cell growth inhibition by the PPAR agonist troglitazone. Chem Biol Interact. 2010 Oct 6;188(1):75-85. doi: 10.1016/j.cbi.2010.06.001. Epub 2010 Jun 9.
• [23] Fumosorinone, a novel PTP1B inhibitor, activates insulin signaling in insulin-resistance HepG2 cells and shows anti-diabetic effect in diabetic KKAy mice. Toxicol Appl Pharmacol. 2015 May 15;285(1):61-70. doi: 10.1016/j.taap.2015.03.011. Epub 2015 Mar 18.
• [24] Ethanol enhances arsenic-induced cyclooxygenase-2 expression via both NFAT and NF-B signalings in colorectal cancer cells. Toxicol Appl Pharmacol. 2015 Oct 15;288(2):232-9.
• [25] Aspirin inhibits proliferation of gemcitabine-resistant human pancreatic cancer cells and augments gemcitabine-induced cytotoxicity. Acta Pharmacol Sin. 2010 Jan;31(1):73-80. doi: 10.1038/aps.2009.172. Epub 2009 Dec 7.
• [26] Transcriptional profiling of testosterone-regulated genes in the skeletal muscle of human immunodeficiency virus-infected men experiencing weight loss. J Clin Endocrinol Metab. 2007 Jul;92(7):2793-802. doi: 10.1210/jc.2006-2722. Epub 2007 Apr 17.
• [27] PARP-1 inhibition-induced activation of PI-3-kinase-Akt pathway promotes resistance to taxol. Biochem Pharmacol. 2009 Apr 15;77(8):1348-57. doi: 10.1016/j.bcp.2009.01.008. Epub 2009 Jan 24.
• [28] Early effects of mood stabilizers on the Akt/GSK-3beta signaling pathway and on cell survival and proliferation. Psychopharmacology (Berl). 2009 Aug;205(3):419-29. doi: 10.1007/s00213-009-1551-2. Epub 2009 May 14.
• [29] Mitomycin induces alveolar epithelial cell senescence by down-regulating GSK3 signaling. Toxicol Lett. 2021 Nov 1;352:61-69. doi: 10.1016/j.toxlet.2021.09.015. Epub 2021 Oct 5.
• [30] Differential effects of simvastatin and pravastatin on expression of Alzheimer's disease-related genes in human astrocytes and neuronal cells. J Lipid Res. 2009 Oct;50(10):2095-102. doi: 10.1194/jlr.M900236-JLR200. Epub 2009 May 21.
• [31] Effect of gemcitabine on the expression of apoptosis-related genes in human pancreatic cancer cells. World J Gastroenterol. 2006 Mar 14;12(10):1597-602. doi: 10.3748/wjg.v12.i10.1597.
• [32] Dysregulation of integrin-linked kinase (ILK) signaling in colonic polyposis. Oncogene. 2001 Sep 27;20(43):6250-7. doi: 10.1038/sj.onc.1204791.
• [33] Methamphetamine exposure upregulates the amyloid precursor protein and hyperphosphorylated tau expression: The roles of insulin signaling in SH-SY5Y cell line. J Toxicol Sci. 2019;44(7):493-503. doi: 10.2131/jts.44.493.
• [34] Effects of metformin and pioglitazone combination on apoptosis and AMPK/mTOR signaling pathway in human anaplastic thyroid cancer cells. J Biochem Mol Toxicol. 2020 Oct;34(10):e22547. doi: 10.1002/jbt.22547. Epub 2020 Jun 26.
• [35] Arsenic trioxide potentiates the anti-cancer activities of sorafenib against hepatocellular carcinoma by inhibiting Akt activation. Tumour Biol. 2015 Apr;36(4):2323-34. doi: 10.1007/s13277-014-2839-3. Epub 2014 Nov 22.
• [36] Effects and mechanisms of betulinic acid on improving EGFR TKI-resistance of lung cancer cells. Environ Toxicol. 2018 Nov;33(11):1153-1159.
• [37] Imatinib disturbs lysosomal function and morphology and impairs the activity of mTORC1 in human hepatocyte cell lines. Food Chem Toxicol. 2022 Apr;162:112869. doi: 10.1016/j.fct.2022.112869. Epub 2022 Feb 16.
• [38] Cryptotanshinone (Dsh-003) from Salvia miltiorrhiza Bunge inhibits prostaglandin E2-induced survival and invasion effects in HA22T hepatocellular carcinoma cells. Environ Toxicol. 2018 Dec;33(12):1254-1260. doi: 10.1002/tox.22633. Epub 2018 Sep 12.
• [39] Lovastatin protects human neurons against Abeta-induced toxicity and causes activation of beta-catenin-TCF/LEF signaling. Neurosci Lett. 2007 Feb 2;412(3):211-6. doi: 10.1016/j.neulet.2006.07.045. Epub 2007 Jan 17.
• [40] Famotidine has a neuroprotective effect on MK-801 induced toxicity via the Akt/GSK-3/-catenin signaling pathway in the SH-SY5Y cell line. Chem Biol Interact. 2019 Dec 1;314:108823. doi: 10.1016/j.cbi.2019.108823. Epub 2019 Sep 26.
• [41] NGBR is required to ameliorate type 2 diabetes in mice by enhancing insulin sensitivity. J Biol Chem. 2021 Jan-Jun;296:100624. doi: 10.1016/j.jbc.2021.100624. Epub 2021 Apr 2.
• [42] Adenosine and Cordycepin Accelerate Tissue Remodeling Process through Adenosine Receptor Mediated Wnt/-Catenin Pathway Stimulation by Regulating GSK3b Activity. Int J Mol Sci. 2021 May 25;22(11):5571. doi: 10.3390/ijms22115571.
• [43] GSK3, snail, and adhesion molecule regulation by cyclosporine A in renal tubular cells. Toxicol Sci. 2012 Jun;127(2):425-37. doi: 10.1093/toxsci/kfs108. Epub 2012 Mar 12.
• [44] Bleomycin-induced nuclear factor-kappaB activation in human bronchial epithelial cells involves the phosphorylation of glycogen synthase kinase 3beta. Toxicol Lett. 2009 Jun 22;187(3):194-200. doi: 10.1016/j.toxlet.2009.02.023. Epub 2009 Mar 13.
• [45] Aspidin PB, a phloroglucinol derivative, induces apoptosis in human hepatocarcinoma HepG2 cells by modulating PI3K/Akt/GSK3 pathway. Chem Biol Interact. 2013 Jan 25;201(1-3):1-8. doi: 10.1016/j.cbi.2012.11.005. Epub 2012 Nov 21.
• [46] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [47] Berberine, a natural antidiabetes drug, attenuates glucose neurotoxicity and promotes Nrf2-related neurite outgrowth. Toxicol Appl Pharmacol. 2013 Nov 1;272(3):787-96. doi: 10.1016/j.taap.2013.08.008. Epub 2013 Aug 15.
• [48] Resveratrol protects mitochondria against oxidative stress through AMP-activated protein kinase-mediated glycogen synthase kinase-3beta inhibition downstream of poly(ADP-ribose)polymerase-LKB1 pathway. Mol Pharmacol. 2009 Oct;76(4):884-95. doi: 10.1124/mol.109.058479. Epub 2009 Jul 20.
• [49] Differential modulation of PI3-kinase/Akt pathway during all-trans retinoic acid- and Am80-induced HL-60 cell differentiation revealed by DNA microarray analysis. Biochem Pharmacol. 2004 Dec 1;68(11):2177-86.
• [50] Impact of quercetin and EGCG on key elements of the Wnt pathway in human colon carcinoma cells. J Agric Food Chem. 2006 Sep 20;54(19):7075-82. doi: 10.1021/jf0612530.
• [51] Revealing the effect of 6-gingerol, 6-shogaol and curcumin on mPGES-1, GSK-3 and -catenin pathway in A549 cell line. Chem Biol Interact. 2016 Oct 25;258:257-65. doi: 10.1016/j.cbi.2016.09.012. Epub 2016 Sep 16.
• [52] Glycogen synthase kinase 3 regulates cell death and survival signaling in tumor cells under redox stress. Neoplasia. 2014 Sep;16(9):710-22.
• [53] Andrographolide inhibits the growth of human osteosarcoma cells by suppressing Wnt/-catenin, PI3K/AKT and NF-B signaling pathways. Chem Biol Interact. 2022 Sep 25;365:110068. doi: 10.1016/j.cbi.2022.110068. Epub 2022 Jul 31.
• [54] Suppression of cancer relapse and metastasis by inhibiting cancer stemness. Proc Natl Acad Sci U S A. 2015 Feb 10;112(6):1839-44. doi: 10.1073/pnas.1424171112. Epub 2015 Jan 20.
• [55] Cannabinoid receptor 1 is a potential drug target for treatment of translocation-positive rhabdomyosarcoma. Mol Cancer Ther. 2009 Jul;8(7):1838-45. doi: 10.1158/1535-7163.MCT-08-1147. Epub 2009 Jun 9.
• [56] Cancer metastasis and EGFR signaling is suppressed by amiodarone-induced versican V2. Oncotarget. 2015 Dec 15;6(40):42976-87. doi: 10.18632/oncotarget.5621.
• [57] Thymoquinone suppresses invasion and metastasis in bladder cancer cells by reversing EMT through the Wnt/-catenin signaling pathway. Chem Biol Interact. 2020 Apr 1;320:109022. doi: 10.1016/j.cbi.2020.109022. Epub 2020 Feb 27.
• [58] Histone acetylation-mediated regulation of the Hippo pathway. PLoS One. 2013 May 6;8(5):e62478. doi: 10.1371/journal.pone.0062478. Print 2013.
• [59] Microarray analyses in dendritic cells reveal potential biomarkers for chemical-induced skin sensitization. Mol Immunol. 2007 May;44(12):3222-33.
• [60] Novel ATP-competitive Akt inhibitor afuresertib suppresses the proliferation of malignant pleural mesothelioma cells. Cancer Med. 2017 Nov;6(11):2646-2659. doi: 10.1002/cam4.1179. Epub 2017 Sep 27.
• [61] Modulation of Akt and ERK1/2 pathways by resveratrol in chronic myelogenous leukemia (CML) cells results in the downregulation of Hsp70. PLoS One. 2010 Jan 14;5(1):e8719. doi: 10.1371/journal.pone.0008719.
• [62] Targeting the Enterohepatic Bile Acid Signaling Induces Hepatic Autophagy via a CYP7A1-AKT-mTOR Axis in Mice. Cell Mol Gastroenterol Hepatol. 2016 Oct 22;3(2):245-260. doi: 10.1016/j.jcmgh.2016.10.002. eCollection 2017 Mar.
• [63] Baicalein induces G1 arrest in oral cancer cells by enhancing the degradation of cyclin D1 and activating AhR to decrease Rb phosphorylation. Toxicol Appl Pharmacol. 2012 Sep 15;263(3):360-7. doi: 10.1016/j.taap.2012.07.010. Epub 2012 Jul 20.
• [64] Biological properties of potent inhibitors of class I phosphatidylinositide 3-kinases: from PI-103 through PI-540, PI-620 to the oral agent GDC-0941. Mol Cancer Ther. 2009 Jul;8(7):1725-38. doi: 10.1158/1535-7163.MCT-08-1200. Epub 2009 Jul 7.
• [65] Discovery of novel AKT inhibitors with enhanced anti-tumor effects in combination with the MEK inhibitor. PLoS One. 2014 Jun 30;9(6):e100880. doi: 10.1371/journal.pone.0100880. eCollection 2014.
• [66] A human embryonic stem cell-based model for benzo[a]pyrene-induced embryotoxicity. Reprod Toxicol. 2019 Apr;85:26-33. doi: 10.1016/j.reprotox.2019.01.008. Epub 2019 Jan 16.
• [67] Increased galectin-3 facilitates leukemia cell survival from apoptotic stimuli. Biochem Biophys Res Commun. 2011 Aug 26;412(2):334-40. doi: 10.1016/j.bbrc.2011.07.099. Epub 2011 Jul 29.
• [68] Tetrandrine induces apoptosis Via caspase-8, -9, and -3 and poly (ADP ribose) polymerase dependent pathways and autophagy through beclin-1/ LC3-I, II signaling pathways in human oral cancer HSC-3 cells. Environ Toxicol. 2016 Apr;31(4):395-406. doi: 10.1002/tox.22053. Epub 2014 Sep 30.
• [69] Hypoxia increases the apoptotic response to betulinic acid and betulin in human non-small cell lung cancer cells. Chem Biol Interact. 2021 Jan 5;333:109320. doi: 10.1016/j.cbi.2020.109320. Epub 2020 Nov 9.
• [70] Induction of apoptosis in human leukemia cells by the tyrosine kinase inhibitor adaphostin proceeds through a RAF-1/MEK/ERK- and AKT-dependent process. Oncogene. 2004 Feb 19;23(7):1364-76. doi: 10.1038/sj.onc.1207248.
• [71] Combined SRPK and AKT pharmacological inhibition is synergistic in T-cell acute lymphoblastic leukemia cells. Toxicol In Vitro. 2020 Jun;65:104777. doi: 10.1016/j.tiv.2020.104777. Epub 2020 Jan 18.
• [72] Caffeine inhibits cell proliferation and regulates PKA/GSK3 pathways in U87MG human glioma cells. Mol Cells. 2011 Mar;31(3):275-9. doi: 10.1007/s10059-011-0027-5. Epub 2010 Dec 30.
• [73] Celecoxib induces apoptosis in COX-2 deficient human gastric cancer cells through Akt/GSK3beta/NAG-1 pathway. Cancer Lett. 2007 Jun 28;251(2):268-77. doi: 10.1016/j.canlet.2006.11.032. Epub 2007 Jan 25.
• [74] Cytoplasmic aryl hydrocarbon receptor regulates glycogen synthase kinase 3 beta, accelerates vimentin degradation, and suppresses epithelial-mesenchymal transition in non-small cell lung cancer cells. Arch Toxicol. 2017 May;91(5):2165-2178.
• [75] Specificity and mechanism of action of some commonly used protein kinase inhibitors. Biochem J. 2000 Oct 1;351(Pt 1):95-105.
• [76] Tissue transglutaminase 2 inhibition promotes cell death and chemosensitivity in glioblastomas. Mol Cancer Ther. 2005 Sep;4(9):1293-302.
• [77] Cell-specific regulation of Nrf2 during ROS-Dependent cell death caused by 2,3,5-tris(glutathion-S-yl)hydroquinone (TGHQ). Chem Biol Interact. 2019 Apr 1;302:1-10. doi: 10.1016/j.cbi.2019.01.027. Epub 2019 Jan 28.
• [78] Pristimerin suppresses colorectal cancer through inhibiting inflammatory responses and Wnt/-catenin signaling. Toxicol Appl Pharmacol. 2020 Jan 1;386:114813. doi: 10.1016/j.taap.2019.114813. Epub 2019 Nov 9.
• [79] Inhibition of cyclooxygenase as potential novel therapeutic strategy in N141I presenilin-2 familial Alzheimer's disease. Mol Psychiatry. 2006 Feb;11(2):172-81. doi: 10.1038/sj.mp.4001773.
• [80] Targeting the beta-catenin/TCF transcriptional complex in the treatment of multiple myeloma. Proc Natl Acad Sci U S A. 2007 May 1;104(18):7516-21. doi: 10.1073/pnas.0610299104. Epub 2007 Apr 23.
• [81] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
• [82] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
• [83] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [84] Liposomal encapsulation of deguelin: evidence for enhanced antitumor activity in tobacco carcinogen-induced and oncogenic K-ras-induced lung tumorigenesis. Cancer Prev Res (Phila). 2009 Apr;2(4):361-9.
• [85] Ochratoxin A activates opposing c-MET/PI3K/Akt and MAPK/ERK 1-2 pathways in human proximal tubule HK-2 cells. Arch Toxicol. 2015 Aug;89(8):1313-27. doi: 10.1007/s00204-014-1311-x. Epub 2014 Jul 8.
• [86] Paraquat induces extrinsic pathway of apoptosis in A549 cells by induction of DR5 and repression of anti-apoptotic proteins, DDX3 and GSK3 expression. Toxicol In Vitro. 2017 Aug;42:123-129. doi: 10.1016/j.tiv.2017.04.016. Epub 2017 Apr 14.
• [87] Microarray analysis of H2O2-, HNE-, or tBH-treated ARPE-19 cells. Free Radic Biol Med. 2002 Nov 15;33(10):1419-32.
• [88] The neuroprotective action of the mood stabilizing drugs lithium chloride and sodium valproate is mediated through the up-regulation of the homeodomain protein Six1. Toxicol Appl Pharmacol. 2009 Feb 15;235(1):124-34.
• [89] Neurotoxicity induced by okadaic acid in the human neuroblastoma SH-SY5Y line can be differentially prevented by 7 and 2* nicotinic stimulation. Toxicol Sci. 2011 Sep;123(1):193-205. doi: 10.1093/toxsci/kfr163. Epub 2011 Jun 29.