Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTL66767)

DOT Name	Sideroflexin-1 (SFXN1)
Gene Name	SFXN1
Related Disease	Colorectal carcinoma ( ) Colorectal neoplasm ( ) Tuberculosis ( ) Urinary bladder cancer ( ) Urinary bladder neoplasm ( ) Bladder cancer ( ) Breast cancer ( ) Breast carcinoma ( ) Endometriosis ( ) Graves disease ( ) Hepatitis B virus infection ( ) Intellectual disability ( ) Liver cirrhosis ( ) Lung adenocarcinoma ( ) Matthew-Wood syndrome ( ) Non-insulin dependent diabetes ( ) Obesity ( ) Polycystic ovarian syndrome ( ) Precancerous condition ( ) Prostate cancer ( ) Prostate carcinoma ( ) Schistosomiasis ( ) Tarsal-carpal coalition syndrome ( ) Thyroid gland undifferentiated (anaplastic) carcinoma ( ) Transitional cell carcinoma ( ) Urinary tract infection ( ) Urothelial carcinoma ( ) Vascular purpura ( ) Alpha-1 antitrypsin deficiency ( ) Periodontitis ( ) Pulmonary emphysema ( ) Adenocarcinoma ( ) Chronic hepatitis B virus infection ( ) Crohn disease ( ) Cystitis ( ) Diphtheria ( ) Hypertrichosis ( ) Neoplasm ( ) Squamous cell carcinoma ( ) Venous thromboembolism ( )
UniProt ID	SFXN1_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Pfam ID	PF03820
Sequence	MSGELPPNINIKEPRWDQSTFIGRANHFFTVTDPRNILLTNEQLESARKIVHDYRQGIVP PGLTENELWRAKYIYDSAFHPDTGEKMILIGRMSAQVPMNMTITGCMMTFYRTTPAVLFW QWINQSFNAVVNYTNRSGDAPLTVNELGTAYVSATTGAVATALGLNALTKHVSPLIGRFV PFAAVAAANCINIPLMRQRELKVGIPVTDENGNRLGESANAAKQAITQVVVSRILMAAPG MAIPPFIMNTLEKKAFLKRFPWMSAPIQVGLVGFCLVFATPLCCALFPQKSSMSVTSLEA ELQAKIQESHPELRRVYFNKGL
Function	Amino acid transporter importing serine, an essential substrate of the mitochondrial branch of the one-carbon pathway, into mitochondria. Mitochondrial serine is then converted to glycine and formate, which exits to the cytosol where it is used to generate the charged folates that serve as one-carbon donors. May also transport other amino acids including alanine and cysteine.
Tissue Specificity	Highly expressed in tissues with high one-carbon metabolism activity, such as blood, liver and kidney.

Molecular Interaction Atlas (MIA) of This DOT

40 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance
Colorectal carcinoma	DIS5PYL0	Definitive	Biomarker	[1]
Colorectal neoplasm	DISR1UCN	Definitive	Biomarker	[1]
Tuberculosis	DIS2YIMD	Definitive	Biomarker	[2]
Urinary bladder cancer	DISDV4T7	Definitive	Biomarker	[3]
Urinary bladder neoplasm	DIS7HACE	Definitive	Biomarker	[3]
Bladder cancer	DISUHNM0	Strong	Biomarker	[3]
Breast cancer	DIS7DPX1	Strong	Genetic Variation	[4]
Breast carcinoma	DIS2UE88	Strong	Genetic Variation	[4]
Endometriosis	DISX1AG8	Strong	Genetic Variation	[5]
Graves disease	DISU4KOQ	Strong	Genetic Variation	[6]
Hepatitis B virus infection	DISLQ2XY	Strong	Genetic Variation	[7]
Intellectual disability	DISMBNXP	Strong	Genetic Variation	[8]
Liver cirrhosis	DIS4G1GX	Strong	Biomarker	[7]
Lung adenocarcinoma	DISD51WR	Strong	Biomarker	[9]
Matthew-Wood syndrome	DISA7HR7	Strong	Biomarker	[10]
Non-insulin dependent diabetes	DISK1O5Z	Strong	Genetic Variation	[11]
Obesity	DIS47Y1K	Strong	Biomarker	[12]
Polycystic ovarian syndrome	DISZ2BNG	Strong	Genetic Variation	[13]
Precancerous condition	DISV06FL	Strong	Genetic Variation	[14]
Prostate cancer	DISF190Y	Strong	Genetic Variation	[15]
Prostate carcinoma	DISMJPLE	Strong	Genetic Variation	[15]
Schistosomiasis	DIS6PD44	Strong	Biomarker	[16]
Tarsal-carpal coalition syndrome	DISY90L2	Strong	Biomarker	[17]
Thyroid gland undifferentiated (anaplastic) carcinoma	DISYBB1W	Strong	Biomarker	[18]
Transitional cell carcinoma	DISWVVDR	Strong	Biomarker	[19]
Urinary tract infection	DISMT6UV	Strong	Biomarker	[3]
Urothelial carcinoma	DISRTNTN	Strong	Biomarker	[20]
Vascular purpura	DIS6ZZMF	Strong	Genetic Variation	[8]
Alpha-1 antitrypsin deficiency	DISQKEHW	moderate	Genetic Variation	[21]
Periodontitis	DISI9JOI	moderate	Genetic Variation	[22]
Pulmonary emphysema	DIS5M7HZ	moderate	Genetic Variation	[21]
Adenocarcinoma	DIS3IHTY	Limited	Biomarker	[23]
Chronic hepatitis B virus infection	DISHL4NT	Limited	Genetic Variation	[24]
Crohn disease	DIS2C5Q8	Limited	Genetic Variation	[25]
Cystitis	DIS2D4B9	Limited	Biomarker	[16]
Diphtheria	DISZWM55	Limited	Biomarker	[26]
Hypertrichosis	DISZUK5W	Limited	Genetic Variation	[27]
Neoplasm	DISZKGEW	Limited	Biomarker	[10]
Squamous cell carcinoma	DISQVIFL	Limited	Biomarker	[16]
Venous thromboembolism	DISUR7CR	Limited	Biomarker	[28]
------------------------------------------------------------------------------------


⏷ Show the Full List of 40 Disease(s)

Molecular Interaction Atlas (MIA)

MIA Detail

Jump to Detail Molecular Interaction Atlas of This DOT

This DOT Affected the Drug Response of 2 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Doxorubicin	DMVP5YE	Approved	Sideroflexin-1 (SFXN1) affects the response to substance of Doxorubicin.	[42]
Vinblastine	DM5TVS3	Approved	Sideroflexin-1 (SFXN1) affects the response to substance of Vinblastine.	[42]
------------------------------------------------------------------------------------

11 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Sideroflexin-1 (SFXN1).	[29]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Sideroflexin-1 (SFXN1).	[30]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Sideroflexin-1 (SFXN1).	[31]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Sideroflexin-1 (SFXN1).	[32]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Sideroflexin-1 (SFXN1).	[33]
Diethylstilbestrol	DMN3UXQ	Approved	Diethylstilbestrol increases the expression of Sideroflexin-1 (SFXN1).	[34]
Rifampicin	DM5DSFZ	Approved	Rifampicin decreases the expression of Sideroflexin-1 (SFXN1).	[35]
Curcumin	DMQPH29	Phase 3	Curcumin decreases the expression of Sideroflexin-1 (SFXN1).	[36]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A increases the expression of Sideroflexin-1 (SFXN1).	[39]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde decreases the expression of Sideroflexin-1 (SFXN1).	[40]
Coumestrol	DM40TBU	Investigative	Coumestrol decreases the expression of Sideroflexin-1 (SFXN1).	[41]
------------------------------------------------------------------------------------


⏷ Show the Full List of 11 Drug(s)

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Sideroflexin-1 (SFXN1).	[37]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the methylation of Sideroflexin-1 (SFXN1).	[38]
------------------------------------------------------------------------------------

References

1	Highly Expressed Genes in Rapidly Proliferating Tumor Cells as New Targets for Colorectal Cancer Treatment.Clin Cancer Res. 2015 Aug 15;21(16):3695-704. doi: 10.1158/1078-0432.CCR-14-2457. Epub 2015 May 5.
2	Association of autophagy-related IRGM polymorphisms with latent versus active tuberculosis infection in a Chinese population.Tuberculosis (Edinb). 2016 Mar;97:47-51. doi: 10.1016/j.tube.2016.01.001. Epub 2016 Jan 9.
3	Detection of circulating MUC7-positive cells by reverse transcription-polymerase chain reaction in bladder cancer patients.Int J Urol. 2004 Jan;11(1):38-43. doi: 10.1111/j.1442-2042.2004.00739.x.
4	Association between TIMP-2 gene polymorphism and breast cancer in Han Chinese women.BMC Cancer. 2019 May 14;19(1):446. doi: 10.1186/s12885-019-5655-8.
5	Association of polymorphisms in MALAT1 with the risk of endometriosis in Southern Chinese women.Biol Reprod. 2020 Apr 15;102(4):943-949. doi: 10.1093/biolre/ioz218.
6	Thymic stromal lymphopoietin gene promoter polymorphisms and expression levels in Graves' disease and Graves' ophthalmopathy.BMC Med Genet. 2012 Nov 30;13:116. doi: 10.1186/1471-2350-13-116.
7	Phylogenetic, virological, and clinical characteristics of genotype C hepatitis B virus with TCC at codon 15 of the precore region.J Clin Microbiol. 2006 Mar;44(3):681-7. doi: 10.1128/JCM.44.3.681-687.2006.
8	Mutations in CYP2U1, DDHD2 and GBA2 genes are rare causes of complicated forms of hereditary spastic paraparesis.J Neurol. 2014 Feb;261(2):373-81. doi: 10.1007/s00415-013-7206-6. Epub 2013 Dec 13.
9	c-Myc targeted regulators of cell metabolism in a transgenic mouse model of papillary lung adenocarcinoma.Oncotarget. 2016 Oct 4;7(40):65514-65539. doi: 10.18632/oncotarget.11804.
10	Development and Biological Analysis of a Novel Orthotopic Peritoneal Dissemination Mouse Model Generated Using a Pancreatic Ductal Adenocarcinoma Cell Line.Pancreas. 2019 Mar;48(3):315-322. doi: 10.1097/MPA.0000000000001253.
11	Haplotypes in vitamin D receptor gene encode risk in diabetic nephropathy.Gene. 2019 Jan 30;683:149-152. doi: 10.1016/j.gene.2018.10.017. Epub 2018 Oct 11.
12	Introduction: Impacting the Social Determinants of Health through a Regional Academic-Community Partnership: The Experience of the Mid-South Transdisciplinary Collaborative Center for Health Disparities Research.Ethn Dis. 2017 Nov 9;27(Suppl 1):277-286. doi: 10.18865/ed.27.S1.277. eCollection 2017.
13	Effect of GnRHR polymorphisms on in vitro fertilization and embryo transfer in patients with polycystic ovary syndrome.J Hum Genet. 2017 Dec;62(12):1065-1071. doi: 10.1038/jhg.2017.85. Epub 2017 Sep 7.
14	Infection with specific Helicobacter pylori-cag pathogenicity island strains is associated with interleukin-1B gene polymorphisms in Venezuelan chronic gastritis patients.Dig Dis Sci. 2011 Feb;56(2):449-56. doi: 10.1007/s10620-010-1316-0. Epub 2010 Jun 29.
15	Implications for prostate cancer of insulin-like growth factor-I (IGF-I) genetic variation and circulating IGF-I levels.J Clin Endocrinol Metab. 2007 Dec;92(12):4820-6. doi: 10.1210/jc.2007-0887. Epub 2007 Oct 2.
16	Is there a correlation between HPV and urinary bladder carcinoma?.Biomed Pharmacother. 2013 Apr;67(3):183-91. doi: 10.1016/j.biopha.2012.10.019. Epub 2012 Dec 7.
17	Expanding an expanded genome: long-read sequencing of Trypanosoma cruzi.Microb Genom. 2018 May;4(5):e000177. doi: 10.1099/mgen.0.000177. Epub 2018 Apr 30.
18	Evidence that one subset of anaplastic thyroid carcinomas are derived from papillary carcinomas due to BRAF and p53 mutations.Cancer. 2005 Jun 1;103(11):2261-8. doi: 10.1002/cncr.21073.
19	Impact of p53, MIB-1 and PECAM-1 expression on the prognosis of urothelial carcinoma of the renal pelvis.Actas Urol Esp. 2014 Oct;38(8):506-14. doi: 10.1016/j.acuro.2014.02.015. Epub 2014 Apr 3.
20	Urothelial carcinoma of the upper urinary tract diagnosed via FGFR3 mutation detection in urine: a case report.BMC Urol. 2012 Aug 8;12:20. doi: 10.1186/1471-2490-12-20.
21	Alpha 1-antitrypsin-deficient variant Siiyama (Ser53[TCC] to Phe53[TTC]) is prevalent in Japan. Status of alpha 1-antitrypsin deficiency in Japan.Am J Respir Crit Care Med. 1995 Dec;152(6 Pt 1):2119-26. doi: 10.1164/ajrccm.152.6.8520784.
22	IL4 gene polymorphisms and their relation to periodontal disease in a Macedonian population.Hum Immunol. 2011 May;72(5):446-50. doi: 10.1016/j.humimm.2011.02.005. Epub 2011 Feb 25.
23	Can bladder adenocarcinomas be distinguished from schistosomiasis-associated bladder cancers by using array comparative genomic hybridization analysis?.Cancer Genet Cytogenet. 2007 Sep;177(2):153-7. doi: 10.1016/j.cancergencyto.2007.06.017.
24	Association of cytokine and cytokine receptor gene polymorphisms with the risk of chronic hepatitis B.Asian Pac J Allergy Immunol. 2013 Dec;31(4):277-85. doi: 10.12932/AP0284.31.4.2013.
25	IL18 polymorphism is associated with an increased risk of Crohn's disease.J Gastroenterol. 2002 Nov;37 Suppl 14:111-6. doi: 10.1007/BF03326428.
26	Inhibition of tumor growth by DT-A expressed under the control of IGF2 P3 and P4 promoter sequences.Mol Ther. 2003 Apr;7(4):535-41. doi: 10.1016/s1525-0016(03)00056-x.
27	Functional analysis of two recurrent amino acid substitutions in the CYP21 gene from Italian patients with congenital adrenal hyperplasia.J Clin Endocrinol Metab. 2004 May;89(5):2402-7. doi: 10.1210/jc.2003-031630.
28	Complement activation assessed by the plasma terminal complement complex and future risk of venous thromboembolism.J Thromb Haemost. 2019 Jun;17(6):934-943. doi: 10.1111/jth.14438. Epub 2019 May 13.
29	Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
30	Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
31	Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
32	Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
33	Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
34	Identification of biomarkers and outcomes of endocrine disruption in human ovarian cortex using In Vitro Models. Toxicology. 2023 Feb;485:153425. doi: 10.1016/j.tox.2023.153425. Epub 2023 Jan 5.
35	Integrated analysis of rifampicin-induced microRNA and gene expression changes in human hepatocytes. Drug Metab Pharmacokinet. 2014;29(4):333-40.
36	Curcumin restores corticosteroid function in monocytes exposed to oxidants by maintaining HDAC2. Am J Respir Cell Mol Biol. 2008 Sep;39(3):312-23. doi: 10.1165/rcmb.2008-0012OC. Epub 2008 Apr 17.
37	Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
38	Expression and DNA methylation changes in human breast epithelial cells after bisphenol A exposure. Int J Oncol. 2012 Jul;41(1):369-77.
39	From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
40	Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
41	Pleiotropic combinatorial transcriptomes of human breast cancer cells exposed to mixtures of dietary phytoestrogens. Food Chem Toxicol. 2009 Apr;47(4):787-95.
42	Gene expression profiling of 30 cancer cell lines predicts resistance towards 11 anticancer drugs at clinically achieved concentrations. Int J Cancer. 2006 Apr 1;118(7):1699-712. doi: 10.1002/ijc.21570.