Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTM99ZWH)

• DOT Name: Transcription factor E3 (TFE3)
• Synonyms: Class E basic helix-loop-helix protein 33; bHLHe33
• Gene Name: TFE3
• Related Disease:
  Metabolic disorder
  Sarcoma
  Syndromic complex neurodevelopmental disorder
  Thyroid gland papillary carcinoma
  Acute monocytic leukemia
  Acute myelogenous leukaemia
  Adrenocortical carcinoma
  Angiosarcoma
  Appendicitis
  Breast cancer
  Breast carcinoma
  Burkitt lymphoma
  Clear cell sarcoma
  Dedifferentiated liposarcoma
  Desmoid tumour
  Epithelial neoplasm
  Head-neck squamous cell carcinoma
  Intellectual developmental disorder, X-linked, syndromic, with pigmentary mosaicism and coarse facies
  Kidney cancer
  Kidney neoplasm
  Malignant soft tissue neoplasm
  Nephrotic syndrome
  Neuroblastoma
  Neurodevelopmental disorder
  Non-small-cell lung cancer
  Pancreatic endocrine carcinoma
  Pancreatic neuroendocrine tumor
  Papillary renal cell carcinoma
  Renal carcinoma
  Soft tissue neoplasm
  Type-1/2 diabetes
  Wiskott-Aldrich syndrome
  Alveolar soft part sarcoma
  Chronic kidney disease
  Complex neurodevelopmental disorder
  Rhabdomyosarcoma
  Soft tissue sarcoma
  Hyperglycemia
  Melanoma
  Microphthalmia
• UniProt ID: TFE3_HUMAN
• PDB ID: 7F09
• Pfam ID: PF11851 ; PF00010 ; PF15951
• Sequence:
  MSHAAEPARDGVEASAEGPRAVFVLLEERRPADSAQLLSLNSLLPESGIVADIELENVLD
  PDSFYELKSQPLPLRSSLPISLQATPATPATLSASSSAGGSRTPAMSSSSSSRVLLRQQL
  MRAQAQEQERRERREQAAAAPFPSPAPASPAISVVGVSAGGHTLSRPPPAQVPREVLKVQ
  THLENPTRYHLQQARRQQVKQYLSTTLGPKLASQALTPPPGPASAQPLPAPEAAHTTGPT
  GSAPNSPMALLTIGSSSEKEIDDVIDEIISLESSYNDEMLSYLPGGTTGLQLPSTLPVSG
  NLLDVYSSQGVATPAITVSNSCPAELPNIKREISETEAKALLKERQKKDNHNLIERRRRF
  NINDRIKELGTLIPKSSDPEMRWNKGTILKASVDYIRKLQKEQQRSKDLESRQRSLEQAN
  RSLQLRIQELELQAQIHGLPVPPTPGLLSLATTSASDSLKPEQLDIEEEGRPGAATFHVG
  GGPAQNAPHQQPPAPPSDALLDLHFPSDHLGDLGDPFHLGLEDILMEEEEGVVGGLSGGA
  LSPLRAASDPLLSSVSPAVSKASSRRSSFSMEEES
• Function: Transcription factor that acts as a master regulator of lysosomal biogenesis and immune response. Specifically recognizes and binds E-box sequences (5'-CANNTG-3'); efficient DNA-binding requires dimerization with itself or with another MiT/TFE family member such as TFEB or MITF. Involved in the cellular response to amino acid availability by acting downstream of MTOR: in the presence of nutrients, TFE3 phosphorylation by MTOR promotes its inactivation. Upon starvation or lysosomal stress, inhibition of MTOR induces TFE3 dephosphorylation, resulting in transcription factor activity. Specifically recognizes and binds the CLEAR-box sequence (5'-GTCACGTGAC-3') present in the regulatory region of many lysosomal genes, leading to activate their expression, thereby playing a central role in expression of lysosomal genes. Maintains the pluripotent state of embryonic stem cells by promoting the expression of genes such as ESRRB; mTOR-dependent TFE3 cytosolic retention and inactivation promotes exit from pluripotency. Required to maintain the naive pluripotent state of hematopoietic stem cell; mTOR-dependent cytoplasmic retention of TFE3 promotes the exit of hematopoietic stem cell from pluripotency. TFE3 activity is also involved in the inhibition of neuronal progenitor differentiation. Acts as a positive regulator of browning of adipose tissue by promoting expression of target genes; mTOR-dependent phosphorylation promotes cytoplasmic retention of TFE3 and inhibits browning of adipose tissue. In association with TFEB, activates the expression of CD40L in T-cells, thereby playing a role in T-cell-dependent antibody responses in activated CD4(+) T-cells and thymus-dependent humoral immunity. Specifically recognizes the MUE3 box, a subset of E-boxes, present in the immunoglobulin enhancer. It also binds very well to a USF/MLTF site. Promotes TGF-beta-induced transcription of COL1A2; via its interaction with TSC22D1 at E-boxes in the gene proximal promoter. May regulate lysosomal positioning in response to nutrient deprivation by promoting the expression of PIP4P1.
• Tissue Specificity: Ubiquitous in fetal and adult tissues.
• KEGG Pathway:
  Mitophagy - animal (hsa04137)
  Transcriptio.l misregulation in cancer (hsa05202)
  Re.l cell carcinoma (hsa05211)

Molecular Interaction Atlas (MIA) of This DOT

40 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Metabolic disorder	DIS71G5H	Definitive	Biomarker	[1]
Sarcoma	DISZDG3U	Definitive	Altered Expression	[2]
Syndromic complex neurodevelopmental disorder	DISJ2RXI	Definitive	X-linked	[3]
Thyroid gland papillary carcinoma	DIS48YMM	Definitive	Genetic Variation	[4]
Acute monocytic leukemia	DIS28NEL	Strong	Genetic Variation	[5]
Acute myelogenous leukaemia	DISCSPTN	Strong	Genetic Variation	[5]
Adrenocortical carcinoma	DISZF4HX	Strong	Biomarker	[6]
Angiosarcoma	DISIYS9W	Strong	Genetic Variation	[7]
Appendicitis	DIS4GOLF	Strong	Biomarker	[8]
Breast cancer	DIS7DPX1	Strong	Altered Expression	[9]
Breast carcinoma	DIS2UE88	Strong	Altered Expression	[9]
Burkitt lymphoma	DIS9D5XU	Strong	Altered Expression	[10]
Clear cell sarcoma	DIS1MTE6	Strong	Biomarker	[11]
Dedifferentiated liposarcoma	DISYJUCJ	Strong	Biomarker	[2]
Desmoid tumour	DISGX357	Strong	Biomarker	[12]
Epithelial neoplasm	DIS0T594	Strong	Biomarker	[13]
Head-neck squamous cell carcinoma	DISF7P24	Strong	Biomarker	[14]
Intellectual developmental disorder, X-linked, syndromic, with pigmentary mosaicism and coarse facies	DISL2DD5	Strong	X-linked	[15]
Kidney cancer	DISBIPKM	Strong	Genetic Variation	[16]
Kidney neoplasm	DISBNZTN	Strong	Genetic Variation	[17]
Malignant soft tissue neoplasm	DISTC6NO	Strong	Altered Expression	[2]
Nephrotic syndrome	DISSPSC2	Strong	Biomarker	[18]
Neuroblastoma	DISVZBI4	Strong	Genetic Variation	[19]
Neurodevelopmental disorder	DIS372XH	Strong	Biomarker	[20]
Non-small-cell lung cancer	DIS5Y6R9	Strong	Altered Expression	[21]
Pancreatic endocrine carcinoma	DISYZ23O	Strong	Biomarker	[22]
Pancreatic neuroendocrine tumor	DISDMPU0	Strong	Biomarker	[22]
Papillary renal cell carcinoma	DIS25HBV	Strong	Biomarker	[20]
Renal carcinoma	DISER9XT	Strong	Genetic Variation	[16]
Soft tissue neoplasm	DISP2OHE	Strong	Genetic Variation	[23]
Type-1/2 diabetes	DISIUHAP	Strong	Biomarker	[24]
Wiskott-Aldrich syndrome	DISATMDB	Strong	Biomarker	[25]
Alveolar soft part sarcoma	DISLKJKZ	moderate	Genetic Variation	[26]
Chronic kidney disease	DISW82R7	moderate	Biomarker	[27]
Complex neurodevelopmental disorder	DISB9AFI	Moderate	Autosomal dominant	[28]
Rhabdomyosarcoma	DISNR7MS	moderate	Biomarker	[29]
Soft tissue sarcoma	DISSN8XB	moderate	Altered Expression	[30]
Hyperglycemia	DIS0BZB5	Limited	Biomarker	[24]
Melanoma	DIS1RRCY	Limited	Altered Expression	[31]
Microphthalmia	DISGEBES	Limited	Altered Expression	[32]

6 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Transcription factor E3 (TFE3).	[33]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Transcription factor E3 (TFE3).	[48]
TAK-243	DM4GKV2	Phase 1	TAK-243 decreases the sumoylation of Transcription factor E3 (TFE3).	[49]
GSK618334	DMJPXZ4	Phase 1	GSK618334 decreases the phosphorylation of Transcription factor E3 (TFE3).	[50]
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 decreases the phosphorylation of Transcription factor E3 (TFE3).	[51]
Coumarin	DM0N8ZM	Investigative	Coumarin decreases the phosphorylation of Transcription factor E3 (TFE3).	[51]

19 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Transcription factor E3 (TFE3).	[34]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Transcription factor E3 (TFE3).	[35]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Transcription factor E3 (TFE3).	[36]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of Transcription factor E3 (TFE3).	[37]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of Transcription factor E3 (TFE3).	[38]
Temozolomide	DMKECZD	Approved	Temozolomide decreases the expression of Transcription factor E3 (TFE3).	[39]
Menadione	DMSJDTY	Approved	Menadione affects the expression of Transcription factor E3 (TFE3).	[40]
Azathioprine	DMMZSXQ	Approved	Azathioprine increases the expression of Transcription factor E3 (TFE3).	[41]
Cytarabine	DMZD5QR	Approved	Cytarabine increases the expression of Transcription factor E3 (TFE3).	[42]
Aspirin	DM672AH	Approved	Aspirin decreases the expression of Transcription factor E3 (TFE3).	[43]
Azacitidine	DMTA5OE	Approved	Azacitidine increases the expression of Transcription factor E3 (TFE3).	[42]
Fenofibrate	DMFKXDY	Approved	Fenofibrate increases the expression of Transcription factor E3 (TFE3).	[44]
Clodronate	DM9Y6X7	Approved	Clodronate decreases the expression of Transcription factor E3 (TFE3).	[44]
Ibuprofen	DM8VCBE	Approved	Ibuprofen increases the expression of Transcription factor E3 (TFE3).	[44]
Urethane	DM7NSI0	Phase 4	Urethane increases the expression of Transcription factor E3 (TFE3).	[45]
Rigosertib	DMOSTXF	Phase 3	Rigosertib affects the expression of Transcription factor E3 (TFE3).	[46]
APR-246	DMNFADH	Phase 2	APR-246 affects the expression of Transcription factor E3 (TFE3).	[47]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A affects the expression of Transcription factor E3 (TFE3).	[52]
Sulforaphane	DMQY3L0	Investigative	Sulforaphane increases the expression of Transcription factor E3 (TFE3).	[53]

References

• [1] TFE3 regulates muscle metabolic gene expression, increases glycogen stores, and enhances insulin sensitivity in mice.Am J Physiol Endocrinol Metab. 2012 Apr 1;302(7):E896-902. doi: 10.1152/ajpendo.00204.2011. Epub 2012 Jan 31.
• [2] Immunohistochemical correlates of recurrent genetic alterations in sarcomas.Genes Chromosomes Cancer. 2019 Feb;58(2):111-123. doi: 10.1002/gcc.22700. Epub 2018 Dec 19.
• [3] Technical standards for the interpretation and reporting of constitutional copy-number variants: a joint consensus recommendation of the American College of Medical Genetics and Genomics (ACMG) and the Clinical Genome Resource (ClinGen). Genet Med. 2020 Feb;22(2):245-257. doi: 10.1038/s41436-019-0686-8. Epub 2019 Nov 6.
• [4] RNA sequencing of Xp11 translocation-associated cancers reveals novel gene fusions and distinctive clinicopathologic correlations.Mod Pathol. 2018 Sep;31(9):1346-1360. doi: 10.1038/s41379-018-0051-5. Epub 2018 Apr 30.
• [5] Hepatic angiomyolipomas may overexpress TFE3, but have no relevant genetic alterations.Hum Pathol. 2017 Mar;61:41-48. doi: 10.1016/j.humpath.2016.11.003. Epub 2016 Nov 16.
• [6] Detection of ASPL/TFE3 fusion transcripts and the TFE3 antigen in formalin-fixed, paraffin-embedded tissue in a series of 18 cases of alveolar soft part sarcoma: useful diagnostic tools in cases with unusual histological features.Virchows Arch. 2011 Mar;458(3):291-300. doi: 10.1007/s00428-010-1039-9. Epub 2011 Jan 29.
• [7] Malignant vascular tumors--an update.Mod Pathol. 2014 Jan;27 Suppl 1:S30-8. doi: 10.1038/modpathol.2013.176.
• [8] Transcription factor E3 protein-positive perivascular epithelioid cell tumor of the appendix presenting as acute appendicitis: a case report and review of the literature.Arch Pathol Lab Med. 2013 Mar;137(3):434-7. doi: 10.5858/arpa.2012-0103-CR.
• [9] Inhibiting ROS-TFE3-dependent autophagy enhances the therapeutic response to metformin in breast cancer.Free Radic Res. 2018 Aug;52(8):872-886. doi: 10.1080/10715762.2018.1485075. Epub 2018 Jul 25.
• [10] Cloning of an Alpha-TFEB fusion in renal tumors harboring the t(6;11)(p21;q13) chromosome translocation.Proc Natl Acad Sci U S A. 2003 May 13;100(10):6051-6. doi: 10.1073/pnas.0931430100. Epub 2003 Apr 28.
• [11] Oncogenic MITF dysregulation in clear cell sarcoma: defining the MiT family of human cancers.Cancer Cell. 2006 Jun;9(6):473-84. doi: 10.1016/j.ccr.2006.04.021.
• [12] Nuclear TFE3 expression is a diagnostic marker for Desmoid-type fibromatosis.Diagn Pathol. 2019 May 1;14(1):34. doi: 10.1186/s13000-019-0814-4.
• [13] SFPQ/PSF-TFE3 renal cell carcinoma: a clinicopathologic study emphasizing extended morphology and reviewing the differences between SFPQ-TFE3 RCC and the corresponding mesenchymal neoplasm despite an identical gene fusion.Hum Pathol. 2017 May;63:190-200. doi: 10.1016/j.humpath.2017.02.022. Epub 2017 Mar 14.
• [14] Hypoxia induces TFE3 expression in head and neck squamous cell carcinoma.Oncotarget. 2016 Mar 8;7(10):11651-63. doi: 10.18632/oncotarget.7309.
• [15] Lysosomal Signaling Licenses Embryonic Stem Cell Differentiation via Inactivation of Tfe3. Cell Stem Cell. 2019 Feb 7;24(2):257-270.e8. doi: 10.1016/j.stem.2018.11.021. Epub 2018 Dec 27.
• [16] Fluorescence in situ hybridization analysis on cytologic smears: An accurate and efficient method in the diagnosis of melanotic Xp11 translocation renal cancer.Diagn Cytopathol. 2018 Sep;46(9):786-789. doi: 10.1002/dc.23961. Epub 2018 May 3.
• [17] Xp11.2 translocation/TFE3 gene fusion renal cell carcinoma with a micropapillary pattern: cases report and literature review.Am J Transl Res. 2019 Jan 15;11(1):327-339. eCollection 2019.
• [18] Sunitinib-induced nephrotic syndrome in association with drug response in a patient with Xp11.2 translocation renal cell carcinoma.Jpn J Clin Oncol. 2011 Nov;41(11):1277-81. doi: 10.1093/jjco/hyr140. Epub 2011 Sep 29.
• [19] Second Reported Case of Pediatric Bladder Alveolar Soft Part Sarcoma as Secondary Malignancy After Prior Cytotoxic Chemotherapy.Urology. 2019 Aug;130:148-150. doi: 10.1016/j.urology.2019.04.002. Epub 2019 Apr 12.
• [20] TFE3-associated neurodevelopmental disorder: A distinct recognizable syndrome.Am J Med Genet A. 2020 Mar;182(3):584-590. doi: 10.1002/ajmg.a.61437. Epub 2019 Dec 12.
• [21] Genetic Analysis Reveals AMPK Is Required to Support Tumor Growth in Murine Kras-Dependent Lung Cancer Models.Cell Metab. 2019 Feb 5;29(2):285-302.e7. doi: 10.1016/j.cmet.2018.10.005. Epub 2018 Nov 8.
• [22] TFE3 is a diagnostic marker for solid pseudopapillary neoplasms of the pancreas.Hum Pathol. 2018 Nov;81:166-175. doi: 10.1016/j.humpath.2018.07.005. Epub 2018 Jul 18.
• [23] Detection of the ASPSCR1-TFE3 gene fusion in paraffin-embedded alveolar soft part sarcomas.Histopathology. 2007 Jun;50(7):881-6. doi: 10.1111/j.1365-2559.2007.02693.x.
• [24] Adenovirus-mediated overexpression of Tcfe3 ameliorates hyperglycaemia in a mouse model of diabetes by upregulating glucokinase in the liver.Diabetologia. 2013 Mar;56(3):635-43. doi: 10.1007/s00125-012-2807-7. Epub 2012 Dec 27.
• [25] Linkage of Wiskott-Aldrich syndrome with three marker loci, DXS426, SYP and TFE3, which map to the Xp11.3-p11.22 region.Hum Genet. 1993 Oct 1;92(3):250-3. doi: 10.1007/BF00244467.
• [26] Lingual Alveolar Soft Part Sarcoma in a 1-Year-Old Infant: Youngest Reported Case With Characteristic ASPSCR1-TFE3 Fusion.Pediatr Dev Pathol. 2019 Jul-Aug;22(4):391-395. doi: 10.1177/1093526619830290. Epub 2019 Feb 11.
• [27] RBM10-TFE3 renal cell carcinoma characterised by paracentric inversion with consistent closely split signals in break-apart fluorescence in-situ hybridisation: study of 10 cases and a literature review.Histopathology. 2019 Aug;75(2):254-265. doi: 10.1111/his.13866. Epub 2019 Jun 25.
• [28] Classification of Genes: Standardized Clinical Validity Assessment of Gene-Disease Associations Aids Diagnostic Exome Analysis and Reclassifications. Hum Mutat. 2017 May;38(5):600-608. doi: 10.1002/humu.23183. Epub 2017 Feb 13.
• [29] Secondary PSF/TFE3-associated renal cell carcinoma in a child treated for genitourinary rhabdomyosarcoma.Cancer Genet. 2011 Feb;204(2):108-10. doi: 10.1016/j.cancergencyto.2010.10.006.
• [30] Expression of MET in alveolar soft part sarcoma.Med Oncol. 2010 Jun;27(2):459-65. doi: 10.1007/s12032-009-9234-8. Epub 2009 May 27.
• [31] MITF has a central role in regulating starvation-induced autophagy in melanoma.Sci Rep. 2019 Jan 31;9(1):1055. doi: 10.1038/s41598-018-37522-6.
• [32] Nutrient deprivation and lysosomal stress induce activation of TFEB in retinal pigment epithelial cells.Cell Mol Biol Lett. 2019 May 27;24:33. doi: 10.1186/s11658-019-0159-8. eCollection 2019.
• [33] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [34] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [35] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [36] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [37] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [38] Low doses of cisplatin induce gene alterations, cell cycle arrest, and apoptosis in human promyelocytic leukemia cells. Biomark Insights. 2016 Aug 24;11:113-21.
• [39] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [40] Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
• [41] A transcriptomics-based in vitro assay for predicting chemical genotoxicity in vivo. Carcinogenesis. 2012 Jul;33(7):1421-9.
• [42] The DNA methyltransferase inhibitors azacitidine, decitabine and zebularine exert differential effects on cancer gene expression in acute myeloid leukemia cells. Leukemia. 2009 Jun;23(6):1019-28.
• [43] Expression profile analysis of human peripheral blood mononuclear cells in response to aspirin. Arch Immunol Ther Exp (Warsz). 2005 Mar-Apr;53(2):151-8.
• [44] Transcriptomics hit the target: monitoring of ligand-activated and stress response pathways for chemical testing. Toxicol In Vitro. 2015 Dec 25;30(1 Pt A):7-18.
• [45] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [46] ON 01910.Na is selectively cytotoxic for chronic lymphocytic leukemia cells through a dual mechanism of action involving PI3K/AKT inhibition and induction of oxidative stress. Clin Cancer Res. 2012 Apr 1;18(7):1979-91. doi: 10.1158/1078-0432.CCR-11-2113. Epub 2012 Feb 20.
• [47] Mutant p53 reactivation by PRIMA-1MET induces multiple signaling pathways converging on apoptosis. Oncogene. 2010 Mar 4;29(9):1329-38. doi: 10.1038/onc.2009.425. Epub 2009 Nov 30.
• [48] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [49] Inhibiting ubiquitination causes an accumulation of SUMOylated newly synthesized nuclear proteins at PML bodies. J Biol Chem. 2019 Oct 18;294(42):15218-15234. doi: 10.1074/jbc.RA119.009147. Epub 2019 Jul 8.
• [50] Protein phosphatase 2A stimulates activation of TFEB and TFE3 transcription factors in response to oxidative stress. J Biol Chem. 2018 Aug 10;293(32):12525-12534. doi: 10.1074/jbc.RA118.003471. Epub 2018 Jun 26.
• [51] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [52] Comprehensive analysis of transcriptomic changes induced by low and high doses of bisphenol A in HepG2 spheroids in vitro and rat liver in vivo. Environ Res. 2019 Jun;173:124-134. doi: 10.1016/j.envres.2019.03.035. Epub 2019 Mar 18.
• [53] Sulforaphane-induced apoptosis in human leukemia HL-60 cells through extrinsic and intrinsic signal pathways and altering associated genes expression assayed by cDNA microarray. Environ Toxicol. 2017 Jan;32(1):311-328.