Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTMN63DH)

• DOT Name: Nuclear pore glycoprotein p62 (NUP62)
• Synonyms: 62 kDa nucleoporin; Nucleoporin Nup62
• Gene Name: NUP62
• Related Disease:
  Adenocarcinoma
  Adult glioblastoma
  Advanced cancer
  Amyloidosis
  Amyotrophic lateral sclerosis
  Arteriosclerosis
  Atherosclerosis
  Breast cancer
  Breast carcinoma
  Chronic obstructive pulmonary disease
  Colorectal carcinoma
  Endometriosis
  Epithelial ovarian cancer
  Familial infantile bilateral striatal necrosis
  Fatty liver disease
  Gastric cancer
  Glioblastoma multiforme
  Glioma
  Hepatitis C virus infection
  Hepatocellular carcinoma
  Inclusion body myositis
  Liver cirrhosis
  Meningococcal disease
  Motor neurone disease
  Neoplasm
  Non-insulin dependent diabetes
  Non-small-cell lung cancer
  Obesity
  Ovarian cancer
  Ovarian neoplasm
  Parkinson disease
  Polymyositis
  Rheumatoid arthritis
  Skin cancer
  Squamous cell carcinoma
  Stomach cancer
  Type-1/2 diabetes
  Leigh syndrome
  B-cell neoplasm
  Carcinoma of liver and intrahepatic biliary tract
  Clear cell renal carcinoma
  Infantile bilateral striatal necrosis
  Intellectual disability
  Liver cancer
  Lung cancer
  Lung carcinoma
  Melanoma
  Paget's disease
  Prostate cancer
  Prostate carcinoma
  Renal cell carcinoma
• UniProt ID: NUP62_HUMAN
• PDB ID: 5IJN; 5IJO; 7PER; 7R5J; 7R5K
• Pfam ID: PF05064
• Sequence:
  MSGFNFGGTGAPTGGFTFGTAKTATTTPATGFSFSTSGTGGFNFGAPFQPATSTPSTGLF
  SLATQTPATQTTGFTFGTATLASGGTGFSLGIGASKLNLSNTAATPAMANPSGFGLGSSN
  LTNAISSTVTSSQGTAPTGFVFGPSTTSVAPATTSGGFSFTGGSTAQPSGFNIGSAGNSA
  QPTAPATLPFTPATPAATTAGATQPAAPTPTATITSTGPSLFASIATAPTSSATTGLSLC
  TPVTTAGAPTAGTQGFSLKAPGAASGTSTTTSTAATATATTTSSSSTTGFALNLKPLAPA
  GIPSNTAAAVTAPPGPGAAAGAAASSAMTYAQLESLINKWSLELEDQERHFLQQATQVNA
  WDRTLIENGEKITSLHREVEKVKLDQKRLDQELDFILSQQKELEDLLSPLEELVKEQSGT
  IYLQHADEEREKTYKLAENIDAQLKRMAQDLKDIIEHLNTSGAPADTSDPLQQICKILNA
  HMDSLQWIDQNSALLQRKVEEVTKVCEGRRKEQERSFRITFD
• Function: Essential component of the nuclear pore complex. The N-terminal is probably involved in nucleocytoplasmic transport. The C-terminal is involved in protein-protein interaction probably via coiled-coil formation, promotes its association with centrosomes and may function in anchorage of p62 to the pore complex. Plays a role in mitotic cell cycle progression by regulating centrosome segregation, centriole maturation and spindle orientation. It might be involved in protein recruitment to the centrosome after nuclear breakdown.
• KEGG Pathway:
  Nucleocytoplasmic transport (hsa03013)
  Amyotrophic lateral sclerosis (hsa05014)
• Reactome Pathway:
  Transport of the SLBP independent Mature mRNA (R-HSA-159227)
  Transport of the SLBP Dependant Mature mRNA (R-HSA-159230)
  Transport of Mature mRNA Derived from an Intronless Transcript (R-HSA-159231)
  Transport of Mature mRNA derived from an Intron-Containing Transcript (R-HSA-159236)
  Rev-mediated nuclear export of HIV RNA (R-HSA-165054)
  Transport of Ribonucleoproteins into the Host Nucleus (R-HSA-168271)
  NS1 Mediated Effects on Host Pathways (R-HSA-168276)
  Viral Messenger RNA Synthesis (R-HSA-168325)
  NEP/NS2 Interacts with the Cellular Export Machinery (R-HSA-168333)
  Regulation of Glucokinase by Glucokinase Regulatory Protein (R-HSA-170822)
  Nuclear import of Rev protein (R-HSA-180746)
  Vpr-mediated nuclear import of PICs (R-HSA-180910)
  snRNP Assembly (R-HSA-191859)
  SUMOylation of DNA damage response and repair proteins (R-HSA-3108214)
  SUMOylation of ubiquitinylation proteins (R-HSA-3232142)
  Nuclear Pore Complex (NPC) Disassembly (R-HSA-3301854)
  Regulation of HSF1-mediated heat shock response (R-HSA-3371453)
  SUMOylation of SUMOylation proteins (R-HSA-4085377)
  SUMOylation of chromatin organization proteins (R-HSA-4551638)
  SUMOylation of RNA binding proteins (R-HSA-4570464)
  SUMOylation of DNA replication proteins (R-HSA-4615885)
  Transcriptional regulation by small RNAs (R-HSA-5578749)
  Defective TPR may confer susceptibility towards thyroid papillary carcinoma (TPC) (R-HSA-5619107)
  tRNA processing in the nucleus (R-HSA-6784531)
  HCMV Early Events (R-HSA-9609690)
  HCMV Late Events (R-HSA-9610379)
  Postmitotic nuclear pore complex (NPC) reformation (R-HSA-9615933)
  SARS-CoV-2 activates/modulates innate and adaptive immune responses (R-HSA-9705671)
  ISG15 antiviral mechanism (R-HSA-1169408)

Molecular Interaction Atlas (MIA) of This DOT

51 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Adenocarcinoma	DIS3IHTY	Strong	Biomarker	[1]
Adult glioblastoma	DISVP4LU	Strong	Altered Expression	[2]
Advanced cancer	DISAT1Z9	Strong	Biomarker	[3]
Amyloidosis	DISHTAI2	Strong	Altered Expression	[4]
Amyotrophic lateral sclerosis	DISF7HVM	Strong	Genetic Variation	[5]
Arteriosclerosis	DISK5QGC	Strong	Biomarker	[6]
Atherosclerosis	DISMN9J3	Strong	Biomarker	[6]
Breast cancer	DIS7DPX1	Strong	Biomarker	[7]
Breast carcinoma	DIS2UE88	Strong	Biomarker	[7]
Chronic obstructive pulmonary disease	DISQCIRF	Strong	Altered Expression	[8]
Colorectal carcinoma	DIS5PYL0	Strong	Biomarker	[3]
Endometriosis	DISX1AG8	Strong	Altered Expression	[9]
Epithelial ovarian cancer	DIS56MH2	Strong	Genetic Variation	[10]
Familial infantile bilateral striatal necrosis	DISTMX8T	Strong	Autosomal recessive	[11]
Fatty liver disease	DIS485QZ	Strong	Biomarker	[12]
Gastric cancer	DISXGOUK	Strong	Altered Expression	[13]
Glioblastoma multiforme	DISK8246	Strong	Biomarker	[2]
Glioma	DIS5RPEH	Strong	Biomarker	[14]
Hepatitis C virus infection	DISQ0M8R	Strong	Altered Expression	[15]
Hepatocellular carcinoma	DIS0J828	Strong	Altered Expression	[3]
Inclusion body myositis	DISZXXG5	Strong	Biomarker	[16]
Liver cirrhosis	DIS4G1GX	Strong	Altered Expression	[17]
Meningococcal disease	DISGDM2Z	Strong	Genetic Variation	[18]
Motor neurone disease	DISUHWUI	Strong	Biomarker	[19]
Neoplasm	DISZKGEW	Strong	Biomarker	[20]
Non-insulin dependent diabetes	DISK1O5Z	Strong	Altered Expression	[21]
Non-small-cell lung cancer	DIS5Y6R9	Strong	Altered Expression	[22]
Obesity	DIS47Y1K	Strong	Biomarker	[6]
Ovarian cancer	DISZJHAP	Strong	Genetic Variation	[10]
Ovarian neoplasm	DISEAFTY	Strong	Genetic Variation	[10]
Parkinson disease	DISQVHKL	Strong	Biomarker	[23]
Polymyositis	DIS5DHFP	Strong	Biomarker	[24]
Rheumatoid arthritis	DISTSB4J	Strong	Altered Expression	[25]
Skin cancer	DISTM18U	Strong	Altered Expression	[26]
Squamous cell carcinoma	DISQVIFL	Strong	Altered Expression	[27]
Stomach cancer	DISKIJSX	Strong	Altered Expression	[13]
Type-1/2 diabetes	DISIUHAP	Strong	Altered Expression	[28]
Leigh syndrome	DISWQU45	Disputed	Autosomal recessive	[29]
B-cell neoplasm	DISVY326	Limited	Biomarker	[30]
Carcinoma of liver and intrahepatic biliary tract	DIS8WA0W	Limited	Altered Expression	[3]
Clear cell renal carcinoma	DISBXRFJ	Limited	Altered Expression	[31]
Infantile bilateral striatal necrosis	DIST0SXY	Limited	Biomarker	[32]
Intellectual disability	DISMBNXP	Limited	Biomarker	[11]
Liver cancer	DISDE4BI	Limited	Altered Expression	[3]
Lung cancer	DISCM4YA	Limited	Altered Expression	[3]
Lung carcinoma	DISTR26C	Limited	Altered Expression	[3]
Melanoma	DIS1RRCY	Limited	Biomarker	[33]
Paget's disease	DISO3MC0	Limited	Biomarker	[34]
Prostate cancer	DISF190Y	Limited	Biomarker	[35]
Prostate carcinoma	DISMJPLE	Limited	Biomarker	[35]
Renal cell carcinoma	DISQZ2X8	Limited	Altered Expression	[31]

3 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Nuclear pore glycoprotein p62 (NUP62).	[36]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Nuclear pore glycoprotein p62 (NUP62).	[42]
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 increases the phosphorylation of Nuclear pore glycoprotein p62 (NUP62).	[45]

8 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Nuclear pore glycoprotein p62 (NUP62).	[37]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Nuclear pore glycoprotein p62 (NUP62).	[38]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Nuclear pore glycoprotein p62 (NUP62).	[39]
Vorinostat	DMWMPD4	Approved	Vorinostat decreases the expression of Nuclear pore glycoprotein p62 (NUP62).	[40]
Menthol	DMG2KW7	Approved	Menthol decreases the expression of Nuclear pore glycoprotein p62 (NUP62).	[41]
Leflunomide	DMR8ONJ	Phase 1 Trial	Leflunomide decreases the expression of Nuclear pore glycoprotein p62 (NUP62).	[43]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of Nuclear pore glycoprotein p62 (NUP62).	[44]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A affects the expression of Nuclear pore glycoprotein p62 (NUP62).	[46]

References

• [1] Prognostic Significance of LC3B and p62/SQSTM1 Expression in Gastric Adenocarcinoma.Anticancer Res. 2019 Dec;39(12):6711-6722. doi: 10.21873/anticanres.13886.
• [2] HMGB1-Induced p62 Overexpression Promotes Snail-Mediated Epithelial-Mesenchymal Transition in Glioblastoma Cells via the Degradation of GSK-3.Theranostics. 2019 Mar 16;9(7):1909-1922. doi: 10.7150/thno.30578. eCollection 2019.
• [3] p62 functions as an oncogene in colorectal cancer through inhibiting apoptosis and promoting cell proliferation by interacting with the vitamin D receptor.Cell Prolif. 2019 May;52(3):e12585. doi: 10.1111/cpr.12585. Epub 2019 Feb 22.
• [4] Orientin Improves Cognition by Enhancing Autophagosome Clearance in an Alzheimer's Mouse Model.J Mol Neurosci. 2019 Oct;69(2):246-253. doi: 10.1007/s12031-019-01353-5. Epub 2019 Jun 26.
• [5] An FTLD-associated SQSTM1 variant impacts Nrf2 and NF-B signalling and is associated with reduced phosphorylation of p62.Mol Cell Neurosci. 2019 Jul;98:32-45. doi: 10.1016/j.mcn.2019.04.001. Epub 2019 Apr 4.
• [6] p62/SQSTM1 and Selective Autophagy in Cardiometabolic Diseases.Antioxid Redox Signal. 2019 Aug 20;31(6):458-471. doi: 10.1089/ars.2018.7649. Epub 2019 Feb 11.
• [7] IL-1 induces p62/SQSTM1 and autophagy in ER(+) /PR(+) BCa cell lines concomitant with ER and PR repression, conferring an ER(-) /PR(-) BCa-like phenotype.J Cell Biochem. 2019 Feb;120(2):1477-1491. doi: 10.1002/jcb.27340. Epub 2018 Oct 15.
• [8] Augmentation of S-Nitrosoglutathione Controls Cigarette Smoke-Induced Inflammatory-Oxidative Stress and Chronic Obstructive Pulmonary Disease-Emphysema Pathogenesis by Restoring Cystic Fibrosis Transmembrane Conductance Regulator Function.Antioxid Redox Signal. 2017 Sep 1;27(7):433-451. doi: 10.1089/ars.2016.6895. Epub 2017 Feb 7.
• [9] NLRC5 and autophagy combined as possible predictors in patients with endometriosis.Fertil Steril. 2018 Oct;110(5):949-956. doi: 10.1016/j.fertnstert.2018.06.028.
• [10] Expression and role of autophagy-associated p62 (SQSTM1) in multidrug resistant ovarian cancer.Gynecol Oncol. 2018 Jul;150(1):143-150. doi: 10.1016/j.ygyno.2018.04.557. Epub 2018 Apr 24.
• [11] Mutated nup62 causes autosomal recessive infantile bilateral striatal necrosis. Ann Neurol. 2006 Aug;60(2):214-22. doi: 10.1002/ana.20902.
• [12] Celecoxib alleviates nonalcoholic fatty liver disease by restoring autophagic flux.Sci Rep. 2018 Mar 7;8(1):4108. doi: 10.1038/s41598-018-22339-0.
• [13] SP1 reduces autophagic flux through activating p62 in gastric cancer cells.Mol Med Rep. 2018 Mar;17(3):4633-4638. doi: 10.3892/mmr.2018.8400. Epub 2018 Jan 9.
• [14] Nrf2 and SQSTM1/p62 jointly contribute to mesenchymal transition and invasion in glioblastoma.Oncogene. 2019 Dec;38(50):7473-7490. doi: 10.1038/s41388-019-0956-6. Epub 2019 Aug 23.
• [15] Hepatitis C virus core or NS3/4A protein expression preconditions hepatocytes against oxidative stress and endoplasmic reticulum stress.Redox Rep. 2019 Dec;24(1):17-26. doi: 10.1080/13510002.2019.1596431.
• [16] Association between TDP-43 and mitochondria in inclusion body myositis.Lab Invest. 2019 Jul;99(7):1041-1048. doi: 10.1038/s41374-019-0233-x. Epub 2019 Feb 11.
• [17] L-Ornithine L-Aspartate for the Treatment of Sarcopenia in Chronic Liver Disease: The Taming of a Vicious Cycle.Can J Gastroenterol Hepatol. 2019 Apr 28;2019:8182195. doi: 10.1155/2019/8182195. eCollection 2019.
• [18] Genome-wide association study identifies variants in the CFH region associated with host susceptibility to meningococcal disease.Nat Genet. 2010 Sep;42(9):772-6. doi: 10.1038/ng.640. Epub 2010 Aug 8.
• [19] Accumulation of dipeptide repeat proteins predates that of TDP-43 in frontotemporal lobar degeneration associated with hexanucleotide repeat expansions in C9ORF72 gene.Neuropathol Appl Neurobiol. 2015 Aug;41(5):601-12. doi: 10.1111/nan.12178. Epub 2015 Apr 30.
• [20] Listeria-based hepatocellular carcinoma vaccine facilitates anti-PD-1 therapy by regulating macrophage polarization.Oncogene. 2020 Feb;39(7):1429-1444. doi: 10.1038/s41388-019-1072-3. Epub 2019 Oct 28.
• [21] The Mitochondrial Antioxidant SS-31 Modulates Oxidative Stress, Endoplasmic Reticulum Stress, and Autophagy in Type 2 Diabetes.J Clin Med. 2019 Aug 28;8(9):1322. doi: 10.3390/jcm8091322.
• [22] AZD9291 promotes autophagy and inhibits PI3K/Akt pathway in NSCLC cancer cells. J Cell Biochem. 2019 Jan;120(1):756-767. doi: 10.1002/jcb.27434. Epub 2018 Aug 26.
• [23] The central regulator p62 between ubiquitin proteasome system and autophagy and its role in the mitophagy and Parkinson's disease.BMB Rep. 2020 Jan;53(1):56-63. doi: 10.5483/BMBRep.2020.53.1.283.
• [24] Sporadic inclusion body myositis: Diagnostic value of p62 immunostaining.Med Clin (Barc). 2019 Dec 13;153(11):437-440. doi: 10.1016/j.medcli.2019.04.022. Epub 2019 Jun 26.
• [25] Arsenic Trioxide in Synergy with Vitamin D Rescues the Defective VDR-PPAR- Functional Module of Autophagy in Rheumatoid Arthritis.PPAR Res. 2019 May 7;2019:6403504. doi: 10.1155/2019/6403504. eCollection 2019.
• [26] Autophagy Controls CSL/RBPJ Stability through a p62/SQSTM1-Dependent Mechanism.Cell Rep. 2018 Sep 18;24(12):3108-3114.e4. doi: 10.1016/j.celrep.2018.08.043.
• [27] Investigation of cancer-associated fibroblasts and p62 expression in oral cancer before and after chemotherapy.J Craniomaxillofac Surg. 2018 Apr;46(4):605-610. doi: 10.1016/j.jcms.2017.12.016. Epub 2018 Jan 12.
• [28] Nicotinate-curcumin ameliorates cognitive impairment in diabetic rats by rescuing autophagic flux in CA1 hippocampus.CNS Neurosci Ther. 2019 Apr;25(4):430-441. doi: 10.1111/cns.13059. Epub 2018 Sep 9.
• [29] Technical standards for the interpretation and reporting of constitutional copy-number variants: a joint consensus recommendation of the American College of Medical Genetics and Genomics (ACMG) and the Clinical Genome Resource (ClinGen). Genet Med. 2020 Feb;22(2):245-257. doi: 10.1038/s41436-019-0686-8. Epub 2019 Nov 6.
• [30] Long Noncoding RNA KCNQ1OT1 Promotes the Progression of Non-Small Cell Lung Cancer via Regulating miR-204-5p/ATG3 Axis.Onco Targets Ther. 2019 Dec 10;12:10787-10797. doi: 10.2147/OTT.S226044. eCollection 2019.
• [31] Discovery of a novel 2,5-dihydroxycinnamic acid-based 5-lipoxygenase inhibitor that induces apoptosis and may impair autophagic flux in RCC4 renal cancer cells.Eur J Med Chem. 2019 Oct 1;179:347-357. doi: 10.1016/j.ejmech.2019.06.060. Epub 2019 Jun 23.
• [32] Advantages and pitfalls of an extended gene panel for investigating complex neurometabolic phenotypes.Brain. 2016 Nov 1;139(11):2844-2854. doi: 10.1093/brain/aww221.
• [33] p62/SQSTM1 Fuels Melanoma Progression by Opposing mRNA Decay of a Selective Set of Pro-metastatic Factors.Cancer Cell. 2019 Jan 14;35(1):46-63.e10. doi: 10.1016/j.ccell.2018.11.008. Epub 2018 Dec 20.
• [34] p62/sequestosome 1 deficiency accelerates osteoclastogenesis in vitro and leads to Paget's disease-like bone phenotypes in mice.J Biol Chem. 2018 Jun 15;293(24):9530-9541. doi: 10.1074/jbc.RA118.002449. Epub 2018 Mar 19.
• [35] Adipocyte p62/SQSTM1 Suppresses Tumorigenesis through Opposite Regulations of Metabolism in Adipose Tissue and Tumor.Cancer Cell. 2018 Apr 9;33(4):770-784.e6. doi: 10.1016/j.ccell.2018.03.001.
• [36] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [37] Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
• [38] Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
• [39] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [40] A genomic approach to predict synergistic combinations for breast cancer treatment. Pharmacogenomics J. 2013 Feb;13(1):94-104. doi: 10.1038/tpj.2011.48. Epub 2011 Nov 15.
• [41] Repurposing L-menthol for systems medicine and cancer therapeutics? L-menthol induces apoptosis through caspase 10 and by suppressing HSP90. OMICS. 2016 Jan;20(1):53-64.
• [42] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [43] Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
• [44] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [45] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [46] A trichostatin A expression signature identified by TempO-Seq targeted whole transcriptome profiling. PLoS One. 2017 May 25;12(5):e0178302. doi: 10.1371/journal.pone.0178302. eCollection 2017.