Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTNQ0G3E)

DOT Name	C1q-related factor (C1QL1)
Synonyms	C1q and tumor necrosis factor-related protein 14; C1q/TNF-related protein 14; Complement component 1 Q subcomponent-like 1
Gene Name	C1QL1
Related Disease	Drug dependence ( ) Precocious puberty ( ) Acute myocardial infarction ( ) Adenoma ( ) Alzheimer disease ( ) Anorexia nervosa cachexia ( ) Anxiety ( ) Anxiety disorder ( ) Atopic dermatitis ( ) Atrial fibrillation ( ) Breast cancer ( ) Breast carcinoma ( ) Cardiovascular disease ( ) Choriocarcinoma ( ) Depression ( ) Focal segmental glomerulosclerosis ( ) Hematuria, benign familial ( ) Hepatocellular carcinoma ( ) High blood pressure ( ) Hyperglycemia ( ) Lupus ( ) Major depressive disorder ( ) Malignant glioma ( ) Neoplasm ( ) Pituitary gland disorder ( ) Post-traumatic stress disorder ( ) Retinoblastoma ( ) Small-cell lung cancer ( ) Systemic lupus erythematosus ( ) Thyroid tumor ( ) Advanced cancer ( ) Chronic kidney disease ( ) Neuroblastoma ( ) Irritable bowel syndrome ( ) Mood disorder ( )
UniProt ID	C1QRF_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Pfam ID	PF00386 ; PF01391
Sequence	MLLVLVVLIPVLVSSGGPEGHYEMLGTCRMVCDPYPARGPGAGARTDGGDALSEQSGAPP PSTLVQGPQGKPGRTGKPGPPGPPGDPGPPGPVGPPGEKGEPGKPGPPGLPGAGGSGAIS TATYTTVPRVAFYAGLKNPHEGYEVLKFDDVVTNLGNNYDAASGKFTCNIPGTYFFTYHV LMRGGDGTSMWADLCKNGQVRASAIAQDADQNYDYASNSVILHLDAGDEVFIKLDGGKAH GGNSNKYSTFSGFIIYSD
Function	May regulate the number of excitatory synapses that are formed on hippocampus neurons. Has no effect on inhibitory synapses.
Tissue Specificity	Expressed in brainstem.

Molecular Interaction Atlas (MIA) of This DOT

35 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance
Drug dependence	DIS9IXRC	Definitive	Biomarker	[1]
Precocious puberty	DISYI2XZ	Definitive	Biomarker	[2]
Acute myocardial infarction	DISE3HTG	Strong	Genetic Variation	[3]
Adenoma	DIS78ZEV	Strong	Biomarker	[4]
Alzheimer disease	DISF8S70	Strong	Biomarker	[5]
Anorexia nervosa cachexia	DISFO5RQ	Strong	Biomarker	[6]
Anxiety	DISIJDBA	Strong	Biomarker	[7]
Anxiety disorder	DISBI2BT	Strong	Biomarker	[7]
Atopic dermatitis	DISTCP41	Strong	Biomarker	[8]
Atrial fibrillation	DIS15W6U	Strong	Biomarker	[9]
Breast cancer	DIS7DPX1	Strong	Biomarker	[10]
Breast carcinoma	DIS2UE88	Strong	Biomarker	[10]
Cardiovascular disease	DIS2IQDX	Strong	Biomarker	[11]
Choriocarcinoma	DISDBVNL	Strong	Altered Expression	[12]
Depression	DIS3XJ69	Strong	Biomarker	[13]
Focal segmental glomerulosclerosis	DISJNHH0	Strong	Genetic Variation	[14]
Hematuria, benign familial	DISCWU1L	Strong	Biomarker	[14]
Hepatocellular carcinoma	DIS0J828	Strong	Biomarker	[15]
High blood pressure	DISY2OHH	Strong	Biomarker	[16]
Hyperglycemia	DIS0BZB5	Strong	Biomarker	[17]
Lupus	DISOKJWA	Strong	Genetic Variation	[18]
Major depressive disorder	DIS4CL3X	Strong	Biomarker	[19]
Malignant glioma	DISFXKOV	Strong	Biomarker	[20]
Neoplasm	DISZKGEW	Strong	Biomarker	[21]
Pituitary gland disorder	DIS7XB48	Strong	Biomarker	[6]
Post-traumatic stress disorder	DISHL1EY	Strong	Biomarker	[22]
Retinoblastoma	DISVPNPB	Strong	Biomarker	[23]
Small-cell lung cancer	DISK3LZD	Strong	Biomarker	[24]
Systemic lupus erythematosus	DISI1SZ7	Strong	Genetic Variation	[18]
Thyroid tumor	DISLVKMD	Strong	Biomarker	[25]
Advanced cancer	DISAT1Z9	moderate	Biomarker	[26]
Chronic kidney disease	DISW82R7	moderate	Biomarker	[27]
Neuroblastoma	DISVZBI4	moderate	Altered Expression	[28]
Irritable bowel syndrome	DIS27206	Limited	Biomarker	[29]
Mood disorder	DISLVMWO	Limited	Biomarker	[13]
------------------------------------------------------------------------------------


⏷ Show the Full List of 35 Disease(s)

Molecular Interaction Atlas (MIA)

MIA Detail

Jump to Detail Molecular Interaction Atlas of This DOT

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of C1q-related factor (C1QL1).	[30]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of C1q-related factor (C1QL1).	[35]
------------------------------------------------------------------------------------

6 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of C1q-related factor (C1QL1).	[31]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of C1q-related factor (C1QL1).	[32]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of C1q-related factor (C1QL1).	[33]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of C1q-related factor (C1QL1).	[34]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of C1q-related factor (C1QL1).	[36]
Sulforaphane	DMQY3L0	Investigative	Sulforaphane decreases the expression of C1q-related factor (C1QL1).	[37]
------------------------------------------------------------------------------------


⏷ Show the Full List of 6 Drug(s)

References

1	Etiological theories of addiction: A comprehensive update on neurobiological, genetic and behavioural vulnerability.Pharmacol Biochem Behav. 2016 Sep;148:59-68. doi: 10.1016/j.pbb.2016.06.005. Epub 2016 Jun 12.
2	Overexpression of corticotropin releasing factor in the central nucleus of the amygdala advances puberty and disrupts reproductive cycles in female rats.Endocrinology. 2014 Oct;155(10):3934-44. doi: 10.1210/en.2014-1339. Epub 2014 Jul 22.
3	Cardiorespiratory Fitness and the Risk of First Acute Myocardial Infarction: The HUNT Study.J Am Heart Assoc. 2019 May 7;8(9):e010293. doi: 10.1161/JAHA.118.010293.
4	Gonadotropin-releasing hormone regulates gonadotropin beta-subunit and chromogranin-B messenger ribonucleic acids in cultured chromogranin-A-positive pituitary adenomas.J Clin Endocrinol Metab. 1990 Sep;71(3):622-30. doi: 10.1210/jcem-71-3-622.
5	Central CRF system perturbation in an Alzheimer's disease knockin mouse model.Neurobiol Aging. 2012 Nov;33(11):2678-91. doi: 10.1016/j.neurobiolaging.2012.01.002. Epub 2012 Feb 14.
6	Development of Cushing's syndrome in corticotropin-releasing factor transgenic mice.Endocrinology. 1992 Jun;130(6):3378-86. doi: 10.1210/endo.130.6.1597149.
7	Helicobacter pylori Vacuolating Cytotoxin A Causes Anorexia and Anxiety via Hypothalamic Urocortin 1 in Mice.Sci Rep. 2019 Apr 12;9(1):6011. doi: 10.1038/s41598-019-42163-4.
8	Association between Stress and the HPA Axis in the Atopic Dermatitis.Int J Mol Sci. 2017 Oct 12;18(10):2131. doi: 10.3390/ijms18102131.
9	High mean platelet volume to platelet count ratio as a predictor on poor outcomes after CABG.Gen Thorac Cardiovasc Surg. 2020 May;68(5):459-466. doi: 10.1007/s11748-019-01202-7. Epub 2019 Sep 12.
10	Yoga has a solid effect on cancer-related fatigue in patients with breast cancer: a meta-analysis.Breast Cancer Res Treat. 2019 Aug;177(1):5-16. doi: 10.1007/s10549-019-05278-w. Epub 2019 May 24.
11	PON1 lactonase activity and its association with cardiovascular disease.Clin Chim Acta. 2020 Jan;500:47-53. doi: 10.1016/j.cca.2019.09.016. Epub 2019 Oct 15.
12	Trans-acting factors dictate the species-specific placental expression of corticotropin-releasing factor genes in choriocarcinoma cell lines.Endocrinology. 1996 Jul;137(7):3000-8. doi: 10.1210/endo.137.7.8770924.
13	Characterization and gonadal hormone regulation of a sexually dimorphic corticotropin-releasing factor receptor 1 cell group.J Comp Neurol. 2019 Apr 15;527(6):1056-1069. doi: 10.1002/cne.24588. Epub 2018 Dec 24.
14	Clinico-pathological correlations in 127 patients in 11 large pedigrees, segregating one of three heterozygous mutations in the COL4A3/ COL4A4 genes associated with familial haematuria and significant late progression to proteinuria and chronic kidney disease from focal segmental glomerulosclerosis.Nephrol Dial Transplant. 2009 Sep;24(9):2721-9. doi: 10.1093/ndt/gfp158. Epub 2009 Apr 8.
15	Urocortin affects migration of hepatic cancer cell lines via differential regulation of cPLA2 and iPLA2.Cell Signal. 2014 May;26(5):1125-34. doi: 10.1016/j.cellsig.2014.02.002. Epub 2014 Feb 8.
16	Association of oxytocin levels and oxytocin receptor gene polymorphism (rs2254298) with cardiovascular risk factors in Brazilian elderly from Primary Health Care.Arch Gerontol Geriatr. 2019 Sep-Oct;84:103903. doi: 10.1016/j.archger.2019.103903. Epub 2019 Jul 3.
17	Prospective evaluation of a dynamic insulin infusion algorithm for non critically-ill diabetic patients: A before-after study.PLoS One. 2019 Jan 28;14(1):e0211425. doi: 10.1371/journal.pone.0211425. eCollection 2019.
18	Polymorphisms of the renin-angiotensin system genes in Brazilian patients with lupus nephropathy.Lupus. 2005;14(5):356-62. doi: 10.1191/0961203305lu2093oa.
19	Evidence for the role of corticotropin-releasing factor in major depressive disorder.Neurosci Biobehav Rev. 2015 Nov;58:63-78. doi: 10.1016/j.neubiorev.2015.07.011. Epub 2015 Aug 10.
20	Expression of mRNAs of urocortin and corticotropin-releasing factor receptors in malignant glioma cell lines.Anticancer Res. 2012 Dec;32(12):5299-307.
21	Corticotropin-releasing factor suppresses glioma progression by upregulation of long non-coding RNA-p21.Life Sci. 2019 Jan 1;216:92-100. doi: 10.1016/j.lfs.2018.07.003. Epub 2018 Jul 5.
22	Psychophysiological treatment outcomes: Corticotropin-releasing factor type 1 receptor antagonist increases inhibition of fear-potentiated startle in PTSD patients.Psychophysiology. 2020 Jan;57(1):e13356. doi: 10.1111/psyp.13356. Epub 2019 Feb 26.
23	GRK3 regulation during CRF- and urocortin-induced CRF1 receptor desensitization.Biochem Biophys Res Commun. 2002 Nov 1;298(3):303-8. doi: 10.1016/s0006-291x(02)02463-4.
24	Corticotropin-releasing factor receptors in human small cell lung carcinoma cells: radioligand binding, second messenger, and northern blot analysis data.Endocrinology. 1994 Oct;135(4):1551-8. doi: 10.1210/endo.135.4.7925116.
25	CRABP1, C1QL1 and LCN2 are biomarkers of differentiated thyroid carcinoma, and predict extrathyroidal extension.BMC Cancer. 2018 Jan 10;18(1):68. doi: 10.1186/s12885-017-3948-3.
26	Development of a Taiwan cancer-related fatigue cognition questionnaire: reliability and validity.Oncotarget. 2017 Apr 25;8(17):28880-28887. doi: 10.18632/oncotarget.16285.
27	Genetic loci associated with renal function measures and chronic kidney disease in children: the Pediatric Investigation for Genetic Factors Linked with Renal Progression Consortium.Nephrol Dial Transplant. 2016 Feb;31(2):262-9. doi: 10.1093/ndt/gfv342. Epub 2015 Sep 28.
28	A requirement for the POU transcription factor, Brn-2, in corticotropin-releasing hormone expression in a neuronal cell line.Mol Endocrinol. 1999 Aug;13(8):1237-48. doi: 10.1210/mend.13.8.0327.
29	Corticotropin-releasing factor induces inflammatory cytokines via the NLRP6-inflammatory cytokine axis in a murine model of irritable bowel syndrome.J Dig Dis. 2019 Mar;20(3):143-151. doi: 10.1111/1751-2980.12704. Epub 2019 Mar 5.
30	Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
31	Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
32	Phenotypic characterization of retinoic acid differentiated SH-SY5Y cells by transcriptional profiling. PLoS One. 2013 May 28;8(5):e63862.
33	Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
34	Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
35	Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
36	Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
37	Transcriptome and DNA methylation changes modulated by sulforaphane induce cell cycle arrest, apoptosis, DNA damage, and suppression of proliferation in human liver cancer cells. Food Chem Toxicol. 2020 Feb;136:111047. doi: 10.1016/j.fct.2019.111047. Epub 2019 Dec 12.