Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTQIUACB)

DOT Name E3 ubiquitin-protein ligase TRIM13 (TRIM13)
Synonyms
EC 2.3.2.27; B-cell chronic lymphocytic leukemia tumor suppressor Leu5; Leukemia-associated protein 5; Putative tumor suppressor RFP2; RING finger protein 77; RING-type E3 ubiquitin transferase TRIM13; Ret finger protein 2; Tripartite motif-containing protein 13
Gene Name TRIM13
Related Disease
Lymphoma, non-Hodgkin, familial ( )
Non-hodgkin lymphoma ( )
Small lymphocytic lymphoma ( )
Acute lymphocytic leukaemia ( )
Adult glioblastoma ( )
Adult lymphoma ( )
Alzheimer disease ( )
Bladder cancer ( )
Bone osteosarcoma ( )
Brain neoplasm ( )
Carcinoma of liver and intrahepatic biliary tract ( )
Colorectal carcinoma ( )
Craniosynostosis ( )
Epithelial ovarian cancer ( )
Glioblastoma multiforme ( )
Graft-versus-host disease ( )
Hepatocellular carcinoma ( )
Immunodeficiency ( )
leukaemia ( )
Liver cancer ( )
Lung cancer ( )
Lung carcinoma ( )
Lymphoid leukemia ( )
Lymphoma ( )
Melanoma ( )
Metabolic disorder ( )
Metastatic malignant neoplasm ( )
Neuroblastoma ( )
Obesity ( )
Osteosarcoma ( )
Ovarian cancer ( )
Ovarian neoplasm ( )
Pediatric lymphoma ( )
Type-1/2 diabetes ( )
Urinary bladder cancer ( )
Urinary bladder neoplasm ( )
Childhood acute lymphoblastic leukemia ( )
Acute myelogenous leukaemia ( )
B-cell lymphoma ( )
B-cell neoplasm ( )
Leukemia ( )
Matthew-Wood syndrome ( )
Non-small-cell lung cancer ( )
Triple negative breast cancer ( )
UniProt ID
TRI13_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
EC Number
2.3.2.27
Pfam ID
PF00643 ; PF13445
Sequence
MELLEEDLTCPICCSLFDDPRVLPCSHNFCKKCLEGILEGSVRNSLWRPAPFKCPTCRKE
TSATGINSLQVNYSLKGIVEKYNKIKISPKMPVCKGHLGQPLNIFCLTDMQLICGICATR
GEHTKHVFCSIEDAYAQERDAFESLFQSFETWRRGDALSRLDTLETSKRKSLQLLTKDSD
KVKEFFEKLQHTLDQKKNEILSDFETMKLAVMQAYDPEINKLNTILQEQRMAFNIAEAFK
DVSEPIVFLQQMQEFREKIKVIKETPLPPSNLPASPLMKNFDTSQWEDIKLVDVDKLSLP
QDTGTFISKIPWSFYKLFLLILLLGLVIVFGPTMFLEWSLFDDLATWKGCLSNFSSYLTK
TADFIEQSVFYWEQVTDGFFIFNERFKNFTLVVLNNVAEFVCKYKLL
Function
Endoplasmic reticulum (ER) membrane anchored E3 ligase involved in the retrotranslocation and turnover of membrane and secretory proteins from the ER through a set of processes named ER-associated degradation (ERAD). This process acts on misfolded proteins as well as in the regulated degradation of correctly folded proteins. Enhances ionizing radiation-induced p53/TP53 stability and apoptosis via ubiquitinating MDM2 and AKT1 and decreasing AKT1 kinase activity through MDM2 and AKT1 proteasomal degradation. Regulates ER stress-induced autophagy, and may act as a tumor suppressor. Also plays a role in innate immune response by stimulating NF-kappa-B activity in the TLR2 signaling pathway. Ubiquitinates TRAF6 via the 'Lys-29'-linked polyubiquitination chain resulting in NF-kappa-B activation. Participates as well in T-cell receptor-mediated NF-kappa-B activation. In the presence of TNF, modulates the IKK complex by regulating IKBKG/NEMO ubiquitination leading to the repression of NF-kappa-B.
Reactome Pathway
ER Quality Control Compartment (ERQC) (R-HSA-901032 )

Molecular Interaction Atlas (MIA) of This DOT

44 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Lymphoma, non-Hodgkin, familial DISCXYIZ Definitive Biomarker [1]
Non-hodgkin lymphoma DISS2Y8A Definitive Biomarker [1]
Small lymphocytic lymphoma DIS30POX Definitive Biomarker [2]
Acute lymphocytic leukaemia DISPX75S Strong Biomarker [3]
Adult glioblastoma DISVP4LU Strong Biomarker [4]
Adult lymphoma DISK8IZR Strong Genetic Variation [5]
Alzheimer disease DISF8S70 Strong Biomarker [6]
Bladder cancer DISUHNM0 Strong Biomarker [7]
Bone osteosarcoma DIST1004 Strong Biomarker [8]
Brain neoplasm DISY3EKS Strong Biomarker [9]
Carcinoma of liver and intrahepatic biliary tract DIS8WA0W Strong Biomarker [10]
Colorectal carcinoma DIS5PYL0 Strong Altered Expression [11]
Craniosynostosis DIS6J405 Strong Biomarker [12]
Epithelial ovarian cancer DIS56MH2 Strong Biomarker [13]
Glioblastoma multiforme DISK8246 Strong Genetic Variation [14]
Graft-versus-host disease DIS0QADF Strong Biomarker [15]
Hepatocellular carcinoma DIS0J828 Strong Biomarker [16]
Immunodeficiency DIS093I0 Strong Biomarker [17]
leukaemia DISS7D1V Strong Biomarker [18]
Liver cancer DISDE4BI Strong Biomarker [10]
Lung cancer DISCM4YA Strong Altered Expression [19]
Lung carcinoma DISTR26C Strong Altered Expression [19]
Lymphoid leukemia DIS65TYQ Strong Biomarker [20]
Lymphoma DISN6V4S Strong Biomarker [5]
Melanoma DIS1RRCY Strong Biomarker [21]
Metabolic disorder DIS71G5H Strong Biomarker [10]
Metastatic malignant neoplasm DIS86UK6 Strong Biomarker [22]
Neuroblastoma DISVZBI4 Strong Genetic Variation [23]
Obesity DIS47Y1K Strong Biomarker [24]
Osteosarcoma DISLQ7E2 Strong Biomarker [8]
Ovarian cancer DISZJHAP Strong Biomarker [13]
Ovarian neoplasm DISEAFTY Strong Biomarker [13]
Pediatric lymphoma DIS51BK2 Strong Genetic Variation [5]
Type-1/2 diabetes DISIUHAP Strong Biomarker [24]
Urinary bladder cancer DISDV4T7 Strong Biomarker [7]
Urinary bladder neoplasm DIS7HACE Strong Biomarker [7]
Childhood acute lymphoblastic leukemia DISJ5D6U moderate Biomarker [3]
Acute myelogenous leukaemia DISCSPTN Limited Biomarker [25]
B-cell lymphoma DISIH1YQ Limited Biomarker [26]
B-cell neoplasm DISVY326 Limited Biomarker [27]
Leukemia DISNAKFL Limited Biomarker [28]
Matthew-Wood syndrome DISA7HR7 Limited Biomarker [29]
Non-small-cell lung cancer DIS5Y6R9 Limited Biomarker [30]
Triple negative breast cancer DISAMG6N Limited Biomarker [31]
------------------------------------------------------------------------------------
⏷ Show the Full List of 44 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
10 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the expression of E3 ubiquitin-protein ligase TRIM13 (TRIM13). [32]
Ciclosporin DMAZJFX Approved Ciclosporin decreases the expression of E3 ubiquitin-protein ligase TRIM13 (TRIM13). [33]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate increases the expression of E3 ubiquitin-protein ligase TRIM13 (TRIM13). [34]
Calcitriol DM8ZVJ7 Approved Calcitriol increases the expression of E3 ubiquitin-protein ligase TRIM13 (TRIM13). [35]
Testosterone DM7HUNW Approved Testosterone increases the expression of E3 ubiquitin-protein ligase TRIM13 (TRIM13). [35]
Methotrexate DM2TEOL Approved Methotrexate increases the expression of E3 ubiquitin-protein ligase TRIM13 (TRIM13). [36]
Dihydrotestosterone DM3S8XC Phase 4 Dihydrotestosterone increases the expression of E3 ubiquitin-protein ligase TRIM13 (TRIM13). [37]
Trichostatin A DM9C8NX Investigative Trichostatin A affects the expression of E3 ubiquitin-protein ligase TRIM13 (TRIM13). [39]
Formaldehyde DM7Q6M0 Investigative Formaldehyde decreases the expression of E3 ubiquitin-protein ligase TRIM13 (TRIM13). [40]
Deguelin DMXT7WG Investigative Deguelin decreases the expression of E3 ubiquitin-protein ligase TRIM13 (TRIM13). [41]
------------------------------------------------------------------------------------
⏷ Show the Full List of 10 Drug(s)
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the methylation of E3 ubiquitin-protein ligase TRIM13 (TRIM13). [38]
------------------------------------------------------------------------------------

References

1 Preclinical Evaluation of Allogeneic CAR T Cells Targeting BCMA for the Treatment of Multiple Myeloma.Mol Ther. 2019 Jun 5;27(6):1126-1138. doi: 10.1016/j.ymthe.2019.04.001. Epub 2019 Apr 8.
2 Safety and tolerability of conditioning chemotherapy followed by CD19-targeted CAR T cells for relapsed/refractory CLL.JCI Insight. 2019 Apr 2;5(9):e122627. doi: 10.1172/jci.insight.122627.
3 Cancer immune therapy for lymphoid malignancies: recent advances.Semin Immunopathol. 2019 Jan;41(1):111-124. doi: 10.1007/s00281-018-0696-7. Epub 2018 Jul 13.
4 CAR-Engineered NK Cells for the Treatment of Glioblastoma: Turning Innate Effectors Into Precision Tools for Cancer Immunotherapy.Front Immunol. 2019 Nov 14;10:2683. doi: 10.3389/fimmu.2019.02683. eCollection 2019.
5 Challenges of driving CD30-directed CAR-T cells to the clinic.BMC Cancer. 2019 Mar 6;19(1):203. doi: 10.1186/s12885-019-5415-9.
6 Positive and negative regulation of adenovirus infection by CAR-like soluble protein, CLSP.Gene Ther. 2007 Aug;14(16):1199-207. doi: 10.1038/sj.gt.3302975. Epub 2007 May 31.
7 Targeting CD46 Enhances Anti-Tumoral Activity of Adenovirus Type 5 for Bladder Cancer.Int J Mol Sci. 2018 Sep 10;19(9):2694. doi: 10.3390/ijms19092694.
8 Treating osteosarcoma with CAR T cells.Scand J Immunol. 2019 Mar;89(3):e12741. doi: 10.1111/sji.12741. Epub 2019 Jan 15.
9 Regional Delivery of Chimeric Antigen Receptor-Engineered T Cells Effectively Targets HER2(+) Breast Cancer Metastasis to the Brain.Clin Cancer Res. 2018 Jan 1;24(1):95-105. doi: 10.1158/1078-0432.CCR-17-2041. Epub 2017 Oct 23.
10 High-Content Analysis of Constitutive Androstane Receptor Nuclear Translocation.Methods Mol Biol. 2019;1966:71-77. doi: 10.1007/978-1-4939-9195-2_6.
11 Theragnosis by a miR-141-3p molecular beacon: simultaneous detection and sensitization of 5-fluorouracil resistant colorectal cancer cells through the activation of the TRIM13-associated apoptotic pathway.Chem Commun (Camb). 2019 Jul 4;55(52):7466-7469. doi: 10.1039/c9cc01944h. Epub 2019 Jun 11.
12 Granulocyte-macrophage colony-stimulating factor inactivation in CAR T-cells prevents monocyte-dependent release of key cytokine release syndrome mediators.J Biol Chem. 2019 Apr 5;294(14):5430-5437. doi: 10.1074/jbc.AC119.007558. Epub 2019 Feb 25.
13 Advances Of Chimeric Antigen Receptor T Cell Therapy In Ovarian Cancer.Onco Targets Ther. 2019 Sep 30;12:8015-8022. doi: 10.2147/OTT.S203550. eCollection 2019.
14 Multiparametric magnetic resonance imaging in the assessment of anti-EGFRvIII chimeric antigen receptor T cell therapy in patients with recurrent glioblastoma.Br J Cancer. 2019 Jan;120(1):54-56. doi: 10.1038/s41416-018-0342-0. Epub 2018 Nov 27.
15 Use of chimeric antigen receptor T cells in allogeneic hematopoietic stem cell transplantation.Immunotherapy. 2019 Jan;11(1):37-44. doi: 10.2217/imt-2018-0089.
16 Adoptive cell transfer therapy for hepatocellular carcinoma.Front Med. 2019 Feb;13(1):3-11. doi: 10.1007/s11684-019-0684-x. Epub 2019 Jan 18.
17 Purinergic targeting enhances immunotherapy of CD73(+) solid tumors with piggyBac-engineered chimeric antigen receptor natural killer cells.J Immunother Cancer. 2018 Dec 4;6(1):136. doi: 10.1186/s40425-018-0441-8.
18 Allogeneic CAR T cell therapies for leukemia.Am J Hematol. 2019 May;94(S1):S50-S54. doi: 10.1002/ajh.25399. Epub 2019 Feb 1.
19 Cisplatin Synergistically Enhances Antitumor Potency of Conditionally Replicating Adenovirus via p53 Dependent or Independent Pathways in Human Lung Carcinoma.Int J Mol Sci. 2019 Mar 5;20(5):1125. doi: 10.3390/ijms20051125.
20 Induced CD20 Expression on B-Cell Malignant Cells Heightened the Cytotoxic Activity of Chimeric Antigen Receptor Engineered T Cells.Hum Gene Ther. 2019 Apr;30(4):497-510. doi: 10.1089/hum.2018.119. Epub 2019 Jan 23.
21 Combinatorial Approach to Improve Cancer Immunotherapy: Rational Drug Design Strategy to Simultaneously Hit Multiple Targets to Kill Tumor Cells and to Activate the Immune System.J Oncol. 2019 Feb 3;2019:5245034. doi: 10.1155/2019/5245034. eCollection 2019.
22 Pancreatic cancer therapy with combined mesothelin-redirected chimeric antigen receptor T cells and cytokine-armed oncolytic adenoviruses.JCI Insight. 2018 Apr 5;3(7):e99573. doi: 10.1172/jci.insight.99573. eCollection 2018 Apr 5.
23 Efficiency of CAR-T Therapy for Treatment of Solid Tumor in Clinical Trials: A Meta-Analysis.Dis Markers. 2019 Feb 11;2019:3425291. doi: 10.1155/2019/3425291. eCollection 2019.
24 The Role of Xenobiotic Receptors on Hepatic Glycolipid Metabolism.Curr Drug Metab. 2019;20(1):29-35. doi: 10.2174/1389200219666180918152241.
25 CAR-T cells beyond CD19, UnCAR-Ted territory.Am J Hematol. 2019 May;94(S1):S34-S41. doi: 10.1002/ajh.25398. Epub 2019 Jan 23.
26 Radiation Priming Chimeric Antigen Receptor T-Cell Therapy in Relapsed/Refractory Diffuse Large B-Cell Lymphoma With High Tumor Burden.J Immunother. 2020 Jan;43(1):32-37. doi: 10.1097/CJI.0000000000000284.
27 T cells redirected against Ig for the immunotherapy of B cell lymphoma.Leukemia. 2020 Mar;34(3):821-830. doi: 10.1038/s41375-019-0607-5. Epub 2019 Oct 17.
28 Immunotherapy in pediatric B-cell acute lymphoblastic leukemia.Hum Immunol. 2019 Jun;80(6):400-408. doi: 10.1016/j.humimm.2019.01.011. Epub 2019 Feb 1.
29 Switchable CAR-T cells mediate remission in metastatic pancreatic ductal adenocarcinoma.Gut. 2019 Jun;68(6):1052-1064. doi: 10.1136/gutjnl-2018-316595. Epub 2018 Aug 18.
30 Mesothelin-targeted second generation CAR-T cells inhibit growth of mesothelin-expressing tumors in vivo.Exp Ther Med. 2019 Jan;17(1):739-747. doi: 10.3892/etm.2018.7015. Epub 2018 Nov 27.
31 EGFR-specific CAR-T cells trigger cell lysis in EGFR-positive TNBC.Aging (Albany NY). 2019 Dec 4;11(23):11054-11072. doi: 10.18632/aging.102510. Epub 2019 Dec 4.
32 Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
33 Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
34 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
35 Effects of 1alpha,25 dihydroxyvitamin D3 and testosterone on miRNA and mRNA expression in LNCaP cells. Mol Cancer. 2011 May 18;10:58.
36 Global molecular effects of tocilizumab therapy in rheumatoid arthritis synovium. Arthritis Rheumatol. 2014 Jan;66(1):15-23.
37 LSD1 activates a lethal prostate cancer gene network independently of its demethylase function. Proc Natl Acad Sci U S A. 2018 May 1;115(18):E4179-E4188.
38 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
39 A trichostatin A expression signature identified by TempO-Seq targeted whole transcriptome profiling. PLoS One. 2017 May 25;12(5):e0178302. doi: 10.1371/journal.pone.0178302. eCollection 2017.
40 Gene expression changes in primary human nasal epithelial cells exposed to formaldehyde in vitro. Toxicol Lett. 2010 Oct 5;198(2):289-95.
41 Neurotoxicity and underlying cellular changes of 21 mitochondrial respiratory chain inhibitors. Arch Toxicol. 2021 Feb;95(2):591-615. doi: 10.1007/s00204-020-02970-5. Epub 2021 Jan 29.