Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTS0BFRD)

DOT Name Mitochondrial inner membrane protein OXA1L (OXA1L)
Synonyms Hsa; OXA1Hs; Oxidase assembly 1-like protein; OXA1-like protein
Gene Name OXA1L
Related Disease
Type-1/2 diabetes ( )
Allergic asthma ( )
Alzheimer disease ( )
Asthma ( )
Autosomal recessive primary microcephaly ( )
Biliary tract cancer ( )
Bone osteosarcoma ( )
Cardiovascular disease ( )
Cryptosporidium infection ( )
Head-neck squamous cell carcinoma ( )
Hepatitis ( )
Hepatitis A virus infection ( )
Hepatocellular carcinoma ( )
Hyperthyroxinemia, familial dysalbuminemic ( )
Hypopigmentation of the skin ( )
Intellectual disability ( )
Lung cancer ( )
Lung carcinoma ( )
Mitochondrial disease ( )
Nervous system disease ( )
Neuroblastoma ( )
Osteoporosis ( )
Osteosarcoma ( )
Pancreatic cancer ( )
Psoriasis ( )
Spinal muscular atrophy ( )
Systemic lupus erythematosus ( )
Thyroid gland carcinoma ( )
Urinary tract infection ( )
Wolf-Hirschhorn syndrome ( )
Colon cancer ( )
Colon carcinoma ( )
Colorectal neoplasm ( )
Female hypogonadism ( )
Rheumatoid arthritis ( )
Toxic shock syndrome ( )
Type-1 diabetes ( )
Advanced cancer ( )
Breast cancer ( )
Breast carcinoma ( )
Myotonic dystrophy ( )
Myotonic dystrophy type 1 ( )
UniProt ID
OXA1L_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
6ZM5; 7A5K
Pfam ID
PF02096
Sequence
MAMGLMCGRRELLRLLQSGRRVHSVAGPSQWLGKPLTTRLLFPAAPCCCRPHYLFLAASG
PRSLSTSAISFAEVQVQAPPVVAATPSPTAVPEVASGETADVVQTAAEQSFAELGLGSYT
PVGLIQNLLEFMHVDLGLPWWGAIAACTVFARCLIFPLIVTGQREAARIHNHLPEIQKFS
SRIREAKLAGDHIEYYKASSEMALYQKKHGIKLYKPLILPVTQAPIFISFFIALREMANL
PVPSLQTGGLWWFQDLTVSDPIYILPLAVTATMWAVLELGAETGVQSSDLQWMRNVIRMM
PLITLPITMHFPTAVFMYWLSSNLFSLVQVSCLRIPAVRTVLKIPQRVVHDLDKLPPREG
FLESFKKGWKNAEMTRQLREREQRMRNQLELAARGPLRQTFTHNPLLQPGKDNPPNIPSS
SSKPKSKYPWHDTLG
Function
Required for the insertion of integral membrane proteins into the mitochondrial inner membrane. Essential for the activity and assembly of cytochrome oxidase. Required for the correct biogenesis of ATP synthase and complex I in mitochondria.
KEGG Pathway
Protein export (hsa03060 )
Reactome Pathway
Mitochondrial translation elongation (R-HSA-5389840 )
Mitochondrial translation termination (R-HSA-5419276 )
Mitochondrial translation initiation (R-HSA-5368286 )

Molecular Interaction Atlas (MIA) of This DOT

42 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Type-1/2 diabetes DISIUHAP Definitive Genetic Variation [1]
Allergic asthma DISHF0H3 Strong Genetic Variation [2]
Alzheimer disease DISF8S70 Strong Genetic Variation [3]
Asthma DISW9QNS Strong Biomarker [2]
Autosomal recessive primary microcephaly DIS29IE3 Strong Genetic Variation [4]
Biliary tract cancer DISBNYQL Strong Biomarker [5]
Bone osteosarcoma DIST1004 Strong Biomarker [6]
Cardiovascular disease DIS2IQDX Strong Biomarker [7]
Cryptosporidium infection DISLBTU2 Strong Biomarker [8]
Head-neck squamous cell carcinoma DISF7P24 Strong Biomarker [9]
Hepatitis DISXXX35 Strong Genetic Variation [10]
Hepatitis A virus infection DISUMFQV Strong Genetic Variation [10]
Hepatocellular carcinoma DIS0J828 Strong Biomarker [5]
Hyperthyroxinemia, familial dysalbuminemic DIS0BPAW Strong Genetic Variation [11]
Hypopigmentation of the skin DIS39YKC Strong Biomarker [12]
Intellectual disability DISMBNXP Strong Genetic Variation [13]
Lung cancer DISCM4YA Strong Biomarker [14]
Lung carcinoma DISTR26C Strong Biomarker [14]
Mitochondrial disease DISKAHA3 Strong CausalMutation [15]
Nervous system disease DISJ7GGT Strong Biomarker [12]
Neuroblastoma DISVZBI4 Strong Altered Expression [16]
Osteoporosis DISF2JE0 Strong Genetic Variation [17]
Osteosarcoma DISLQ7E2 Strong Biomarker [6]
Pancreatic cancer DISJC981 Strong Biomarker [18]
Psoriasis DIS59VMN Strong Biomarker [19]
Spinal muscular atrophy DISTLKOB Strong Biomarker [20]
Systemic lupus erythematosus DISI1SZ7 Strong Biomarker [21]
Thyroid gland carcinoma DISMNGZ0 Strong Biomarker [22]
Urinary tract infection DISMT6UV Strong Biomarker [23]
Wolf-Hirschhorn syndrome DISE4WMQ Strong Genetic Variation [13]
Colon cancer DISVC52G moderate Biomarker [24]
Colon carcinoma DISJYKUO moderate Biomarker [24]
Colorectal neoplasm DISR1UCN moderate Altered Expression [24]
Female hypogonadism DISWASB4 moderate Genetic Variation [25]
Rheumatoid arthritis DISTSB4J moderate Biomarker [26]
Toxic shock syndrome DISX5S53 Disputed Biomarker [27]
Type-1 diabetes DIS7HLUB Disputed Biomarker [1]
Advanced cancer DISAT1Z9 Limited Biomarker [28]
Breast cancer DIS7DPX1 Limited Genetic Variation [29]
Breast carcinoma DIS2UE88 Limited Genetic Variation [29]
Myotonic dystrophy DISNBEMX Limited Biomarker [30]
Myotonic dystrophy type 1 DISJC0OX Limited Biomarker [30]
------------------------------------------------------------------------------------
⏷ Show the Full List of 42 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
5 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Acetaminophen DMUIE76 Approved Acetaminophen decreases the expression of Mitochondrial inner membrane protein OXA1L (OXA1L). [31]
Cisplatin DMRHGI9 Approved Cisplatin increases the expression of Mitochondrial inner membrane protein OXA1L (OXA1L). [32]
Ivermectin DMDBX5F Approved Ivermectin decreases the expression of Mitochondrial inner membrane protein OXA1L (OXA1L). [33]
THAPSIGARGIN DMDMQIE Preclinical THAPSIGARGIN increases the expression of Mitochondrial inner membrane protein OXA1L (OXA1L). [34]
Deguelin DMXT7WG Investigative Deguelin increases the expression of Mitochondrial inner membrane protein OXA1L (OXA1L). [35]
------------------------------------------------------------------------------------

References

1 Therapeutic administration of Tregitope-Human Albumin Fusion with Insulin Peptides to promote Antigen-Specific Adaptive Tolerance Induction.Sci Rep. 2019 Nov 6;9(1):16103. doi: 10.1038/s41598-019-52331-1.
2 Polymorphisms in the DAD1 and OXA1L genes are associated with asthma and atopy in a South American population.Mol Immunol. 2018 Sep;101:294-302. doi: 10.1016/j.molimm.2018.07.014. Epub 2018 Jul 19.
3 Genetic linkage in the mouse of genes involved in Down syndrome and Alzheimer's disease in man.Brain Res. 1987 Sep;388(3):215-21. doi: 10.1016/0169-328x(87)90028-3.
4 CDK6 associates with the centrosome during mitosis and is mutated in a large Pakistani family with primary microcephaly. Hum Mol Genet. 2013 Dec 20;22(25):5199-214. doi: 10.1093/hmg/ddt374. Epub 2013 Aug 4.
5 Claudin-4 differentiates biliary tract cancers from hepatocellular carcinomas.Mod Pathol. 2006 Mar;19(3):460-9. doi: 10.1038/modpathol.3800549.
6 Modulation of apoptotic signalling by 9-hydroxystearic acid in osteosarcoma cells.Biochim Biophys Acta. 2007 Feb;1771(2):139-46. doi: 10.1016/j.bbalip.2006.11.012. Epub 2006 Dec 13.
7 Effects of statins on the secretion of human serum albumin in cultured HepG2 cells.J Biomed Sci. 2009 Mar 16;16(1):32. doi: 10.1186/1423-0127-16-32.
8 Decrypting the oscillating nature of the 4'-phosphopantetheine arm in acyl carrier protein AcpM of Mycobacteriumtuberculosis.FEBS Lett. 2019 Mar;593(6):622-633. doi: 10.1002/1873-3468.13339. Epub 2019 Mar 8.
9 Enhancing radiosensitization in EphB4 receptor-expressing Head and Neck Squamous Cell Carcinomas.Sci Rep. 2016 Dec 12;6:38792. doi: 10.1038/srep38792.
10 Development of Kupffer cell targeting type-I interferon for the treatment of hepatitis via inducing anti-inflammatory and immunomodulatory actions.Drug Deliv. 2018 Nov;25(1):1067-1077. doi: 10.1080/10717544.2018.1464083.
11 Homozygous Mutation in Human Serum Albumin and Its Implication on Thyroid Tests.Thyroid. 2018 Jun;28(6):811-814. doi: 10.1089/thy.2017.0564. Epub 2018 May 24.
12 The rat microphthalmia-associated transcription factor gene (Mitf) maps at 4q34-q41 and is mutated in the mib rats.Mamm Genome. 1998 Aug;9(8):617-21. doi: 10.1007/s003359900832.
13 First known microdeletion within the Wolf-Hirschhorn syndrome critical region refines genotype-phenotype correlation.Am J Med Genet. 2001 Apr 1;99(4):338-42. doi: 10.1002/ajmg.1203.
14 Targeting sialic acid residues on lung cancer cells by inhalable boronic acid-decorated albumin nanocomposites for combined chemo/herbal therapy.J Control Release. 2018 Sep 10;285:230-243. doi: 10.1016/j.jconrel.2018.07.014. Epub 2018 Jul 25.
15 OXA1L mutations cause mitochondrial encephalopathy and a combined oxidative phosphorylation defect.EMBO Mol Med. 2018 Nov;10(11):e9060. doi: 10.15252/emmm.201809060.
16 High level of stabilized angiostatin mediated by adenovirus delivery does not impair the growth of human neuroblastoma xenografts.Cancer Gene Ther. 2003 Nov;10(11):859-66. doi: 10.1038/sj.cgt.7700639.
17 Inhibition of osteoporosis by the v3 integrin antagonist of rhodostomin variants.Eur J Pharmacol. 2017 Jun 5;804:94-101. doi: 10.1016/j.ejphar.2017.03.019. Epub 2017 Mar 14.
18 Effect of combination treatment with a vitamin D analog (OCT) and a bisphosphonate (AHPrBP) in a nude mouse model of cancer-associated hypercalcemia.J Bone Miner Res. 1998 Sep;13(9):1378-83. doi: 10.1359/jbmr.1998.13.9.1378.
19 Affinity of 22-oxa-1,25(OH)2D3 for 1,25-dihydroxyvitamin D receptor and its effects on the synthesis of osteocalcin in human osteosarcoma cells.Biochem Biophys Res Commun. 1990 Jun 15;169(2):629-35. doi: 10.1016/0006-291x(90)90377-y.
20 Neuronal SMN expression corrects spinal muscular atrophy in severe SMA mice while muscle-specific SMN expression has no phenotypic effect.Hum Mol Genet. 2008 Apr 15;17(8):1063-75. doi: 10.1093/hmg/ddm379. Epub 2008 Jan 4.
21 Autoantibodies Against Albumin in Patients With Systemic Lupus Erythematosus.Front Immunol. 2018 Oct 2;9:2090. doi: 10.3389/fimmu.2018.02090. eCollection 2018.
22 Effect of 22-oxa-1,25-dihydroxyvitamin D3 on human thyroid cancer cell growth.Endocr J. 1999 Apr;46(2):243-52. doi: 10.1507/endocrj.46.243.
23 Molecular characteristics of extended-spectrum beta-lactamase-producing Escherichia coli from the Chicago area: high prevalence of ST131 producing CTX-M-15 in community hospitals.Int J Antimicrob Agents. 2010 Jul;36(1):19-23. doi: 10.1016/j.ijantimicag.2010.02.016. Epub 2010 Mar 31.
24 Sequestration of 9-Hydroxystearic Acid in FAHFA (Fatty Acid Esters of Hydroxy Fatty Acids) as a Protective Mechanism for Colon Carcinoma Cells to Avoid Apoptotic Cell Death.Cancers (Basel). 2019 Apr 12;11(4):524. doi: 10.3390/cancers11040524.
25 Contribution of domestic animals to the identification of new genes involved in sex determination.J Exp Zool. 2001 Dec 1;290(7):700-8. doi: 10.1002/jez.1120.
26 Secreted Protein Acidic and Rich in Cysteine Mediated Biomimetic Delivery of Methotrexate by Albumin-Based Nanomedicines for Rheumatoid Arthritis Therapy.ACS Nano. 2019 May 28;13(5):5036-5048. doi: 10.1021/acsnano.9b01710. Epub 2019 Apr 25.
27 Preliminary investigation of human serum albumin-V inhibition on toxic shock syndrome induced by staphylococcus enterotoxin B in vitro and in vivo.Toxicon. 2016 Apr;113:55-9. doi: 10.1016/j.toxicon.2016.01.050. Epub 2016 Jan 12.
28 Nucleus-Targeted Organoiridium-Albumin Conjugate for Photodynamic Cancer Therapy.Angew Chem Int Ed Engl. 2019 Feb 18;58(8):2350-2354. doi: 10.1002/anie.201813002. Epub 2019 Jan 21.
29 A rare eicosanoid precursor analogue, sciadonic acid (5Z,11Z,14Z-20:3), detected in vivo in hormone positive breast cancer tissue.Prostaglandins Leukot Essent Fatty Acids. 2018 Jul;134:1-6. doi: 10.1016/j.plefa.2018.05.002. Epub 2018 May 16.
30 Muscleblind-Like 1 and Muscleblind-Like 3 Depletion Synergistically Enhances Myotonia by Altering Clc-1 RNA Translation.EBioMedicine. 2015 Jul 31;2(9):1034-47. doi: 10.1016/j.ebiom.2015.07.028. eCollection 2015 Sep.
31 Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
32 Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
33 Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
34 Endoplasmic reticulum stress impairs insulin signaling through mitochondrial damage in SH-SY5Y cells. Neurosignals. 2012;20(4):265-80.
35 Neurotoxicity and underlying cellular changes of 21 mitochondrial respiratory chain inhibitors. Arch Toxicol. 2021 Feb;95(2):591-615. doi: 10.1007/s00204-020-02970-5. Epub 2021 Jan 29.