Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTSL94KH)

• DOT Name: C-X-C motif chemokine 3 (CXCL3)
• Synonyms: GRO-gamma(1-73); Growth-regulated protein gamma; GRO-gamma; Macrophage inflammatory protein 2-beta; MIP2-beta
• Gene Name: CXCL3
• Related Disease:
  Familial hypercholesterolemia
  Hypercholesterolemia, familial, 1
  Breast cancer
  Breast carcinoma
  Breast neoplasm
  Cervical cancer
  Classic Hodgkin lymphoma
  Colitis
  Colon carcinoma
  Esophageal squamous cell carcinoma
  Huntington disease
  Neoplasm
  Neuralgia
  Prostate cancer
  Prostate carcinoma
  Skin disease
  Cutaneous leishmaniasis
  Rheumatoid arthritis
  Chronic obstructive pulmonary disease
  Colon adenocarcinoma
  Colon cancer
  Colorectal carcinoma
  Stroke
  Subarachnoid hemorrhage
• UniProt ID: CXCL3_HUMAN
• Pfam ID: PF00048
• Sequence:
  MAHATLSAAPSNPRLLRVALLLLLLVAASRRAAGASVVTELRCQCLQTLQGIHLKNIQSV
  NVRSPGPHCAQTEVIATLKNGKKACLNPASPMVQKIIEKILNKGSTN
• Function: Ligand for CXCR2. Has chemotactic activity for neutrophils. May play a role in inflammation and exert its effects on endothelial cells in an autocrine fashion. In vitro, the processed form GRO-gamma(5-73) shows a fivefold higher chemotactic activity for neutrophilic granulocytes.
• KEGG Pathway:
  Cytokine-cytokine receptor interaction (hsa04060)
  Viral protein interaction with cytokine and cytokine receptor (hsa04061)
  Chemokine sig.ling pathway (hsa04062)
  NF-kappa B sig.ling pathway (hsa04064)
  NOD-like receptor sig.ling pathway (hsa04621)
  IL-17 sig.ling pathway (hsa04657)
  TNF sig.ling pathway (hsa04668)
  Alcoholic liver disease (hsa04936)
  Epithelial cell sig.ling in Helicobacter pylori infection (hsa05120)
  Legionellosis (hsa05134)
  Amoebiasis (hsa05146)
  Kaposi sarcoma-associated herpesvirus infection (hsa05167)
  Rheumatoid arthritis (hsa05323)
  Lipid and atherosclerosis (hsa05417)
• Reactome Pathway:
  G alpha (i) signalling events (R-HSA-418594)
  Chemokine receptors bind chemokines (R-HSA-380108)

Molecular Interaction Atlas (MIA) of This DOT

24 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Familial hypercholesterolemia	DISC06IX	Definitive	Altered Expression	[1]
Hypercholesterolemia, familial, 1	DISU411W	Definitive	Altered Expression	[1]
Breast cancer	DIS7DPX1	Strong	Biomarker	[2]
Breast carcinoma	DIS2UE88	Strong	Biomarker	[2]
Breast neoplasm	DISNGJLM	Strong	Altered Expression	[2]
Cervical cancer	DISFSHPF	Strong	Biomarker	[3]
Classic Hodgkin lymphoma	DISV1LU6	Strong	Altered Expression	[4]
Colitis	DISAF7DD	Strong	Biomarker	[5]
Colon carcinoma	DISJYKUO	Strong	Altered Expression	[6]
Esophageal squamous cell carcinoma	DIS5N2GV	Strong	Biomarker	[7]
Huntington disease	DISQPLA4	Strong	Altered Expression	[4]
Neoplasm	DISZKGEW	Strong	Altered Expression	[8]
Neuralgia	DISWO58J	Strong	Biomarker	[9]
Prostate cancer	DISF190Y	Strong	Biomarker	[10]
Prostate carcinoma	DISMJPLE	Strong	Biomarker	[10]
Skin disease	DISDW8R6	Strong	Biomarker	[11]
Cutaneous leishmaniasis	DISRK7TS	Disputed	Biomarker	[12]
Rheumatoid arthritis	DISTSB4J	Disputed	Biomarker	[13]
Chronic obstructive pulmonary disease	DISQCIRF	Limited	Altered Expression	[14]
Colon adenocarcinoma	DISDRE0J	Limited	Biomarker	[14]
Colon cancer	DISVC52G	Limited	Altered Expression	[6]
Colorectal carcinoma	DIS5PYL0	Limited	Altered Expression	[15]
Stroke	DISX6UHX	Limited	Biomarker	[16]
Subarachnoid hemorrhage	DISI7I8Y	Limited	Biomarker	[17]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the methylation of C-X-C motif chemokine 3 (CXCL3).	[18]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of C-X-C motif chemokine 3 (CXCL3).	[34]

26 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of C-X-C motif chemokine 3 (CXCL3).	[19]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of C-X-C motif chemokine 3 (CXCL3).	[20]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of C-X-C motif chemokine 3 (CXCL3).	[21]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate affects the expression of C-X-C motif chemokine 3 (CXCL3).	[22]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of C-X-C motif chemokine 3 (CXCL3).	[23]
Arsenic	DMTL2Y1	Approved	Arsenic decreases the expression of C-X-C motif chemokine 3 (CXCL3).	[11]
Calcitriol	DM8ZVJ7	Approved	Calcitriol increases the expression of C-X-C motif chemokine 3 (CXCL3).	[26]
Methotrexate	DM2TEOL	Approved	Methotrexate decreases the expression of C-X-C motif chemokine 3 (CXCL3).	[27]
Fulvestrant	DM0YZC6	Approved	Fulvestrant increases the expression of C-X-C motif chemokine 3 (CXCL3).	[23]
Dexamethasone	DMMWZET	Approved	Dexamethasone decreases the expression of C-X-C motif chemokine 3 (CXCL3).	[28]
Cannabidiol	DM0659E	Approved	Cannabidiol increases the expression of C-X-C motif chemokine 3 (CXCL3).	[29]
Piroxicam	DMTK234	Approved	Piroxicam decreases the expression of C-X-C motif chemokine 3 (CXCL3).	[30]
Gemcitabine	DMSE3I7	Approved	Gemcitabine increases the expression of C-X-C motif chemokine 3 (CXCL3).	[31]
Bicalutamide	DMZMSPF	Approved	Bicalutamide increases the expression of C-X-C motif chemokine 3 (CXCL3).	[32]
Prednisolone	DMQ8FR2	Approved	Prednisolone decreases the expression of C-X-C motif chemokine 3 (CXCL3).	[30]
Methylprednisolone	DM4BDON	Approved	Methylprednisolone decreases the expression of C-X-C motif chemokine 3 (CXCL3).	[30]
Fenretinide	DMRD5SP	Phase 3	Fenretinide increases the expression of C-X-C motif chemokine 3 (CXCL3).	[33]
Leflunomide	DMR8ONJ	Phase 1 Trial	Leflunomide increases the expression of C-X-C motif chemokine 3 (CXCL3).	[35]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A affects the expression of C-X-C motif chemokine 3 (CXCL3).	[36]
Acetaldehyde	DMJFKG4	Investigative	Acetaldehyde increases the expression of C-X-C motif chemokine 3 (CXCL3).	[37]
methyl p-hydroxybenzoate	DMO58UW	Investigative	methyl p-hydroxybenzoate increases the expression of C-X-C motif chemokine 3 (CXCL3).	[38]
Nickel chloride	DMI12Y8	Investigative	Nickel chloride increases the expression of C-X-C motif chemokine 3 (CXCL3).	[39]
Phencyclidine	DMQBEYX	Investigative	Phencyclidine increases the expression of C-X-C motif chemokine 3 (CXCL3).	[40]
Manganese	DMKT129	Investigative	Manganese increases the expression of C-X-C motif chemokine 3 (CXCL3).	[41]
crotylaldehyde	DMTWRQI	Investigative	crotylaldehyde decreases the expression of C-X-C motif chemokine 3 (CXCL3).	[42]
(E)-4-(3,5-dimethoxystyryl)phenol	DMYXI2V	Investigative	(E)-4-(3,5-dimethoxystyryl)phenol increases the expression of C-X-C motif chemokine 3 (CXCL3).	[43]

1 Drug(s) Affected the Protein Interaction/Cellular Processes of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Temozolomide	DMKECZD	Approved	Temozolomide decreases the secretion of C-X-C motif chemokine 3 (CXCL3).	[25]

References

• [1] Overexpression of the CXCL3 gene in response to oxidized low-density lipoprotein is associated with the presence of tendon xanthomas in familial hypercholesterolemia.Biochem Cell Biol. 2009 Jun;87(3):493-8. doi: 10.1139/o09-006.
• [2] CXCL3 is a potential target for breast cancer metastasis.Curr Cancer Drug Targets. 2014;14(3):294-309. doi: 10.2174/1568009614666140305222328.
• [3] CXCL3 overexpression promotes the tumorigenic potential of uterine cervical cancer cells via the MAPK/ERK pathway.J Cell Physiol. 2020 May;235(5):4756-4765. doi: 10.1002/jcp.29353. Epub 2019 Oct 30.
• [4] Reduced pro-inflammatory responses to Staphylococcus aureus bloodstream infection and low prevalence of enterotoxin genes in isolates from patients on haemodialysis.Eur J Clin Microbiol Infect Dis. 2017 Jan;36(1):33-42. doi: 10.1007/s10096-016-2767-9. Epub 2016 Sep 9.
• [5] Dipotassium Glycyrrhizate Improves Intestinal Mucosal Healing by Modulating Extracellular Matrix Remodeling Genes and Restoring Epithelial Barrier Functions.Front Immunol. 2019 Apr 26;10:939. doi: 10.3389/fimmu.2019.00939. eCollection 2019.
• [6] Diagnostic and prognostic values of CXC motif chemokine ligand 3 in patients with colon cancer.Oncol Rep. 2019 Nov;42(5):1996-2008. doi: 10.3892/or.2019.7326. Epub 2019 Sep 19.
• [7] IL-17 induces antitumor immunity by promoting beneficial neutrophil recruitment and activation in esophageal squamous cell carcinoma.Oncoimmunology. 2017 Sep 21;7(1):e1373234. doi: 10.1080/2162402X.2017.1373234. eCollection 2017.
• [8] KRAS-IRF2 Axis Drives Immune Suppression and Immune Therapy Resistance in Colorectal Cancer.Cancer Cell. 2019 Apr 15;35(4):559-572.e7. doi: 10.1016/j.ccell.2019.02.008. Epub 2019 Mar 21.
• [9] Pharmacological Blockade of Spinal CXCL3/CXCR2 Signaling by NVP CXCR2 20, a Selective CXCR2 Antagonist, Reduces Neuropathic Pain Following Peripheral Nerve Injury.Front Immunol. 2019 Sep 26;10:2198. doi: 10.3389/fimmu.2019.02198. eCollection 2019.
• [10] Chemokine CXCL3 mediates prostate cancer cells proliferation, migration and gene expression changes in an autocrine/paracrine fashion.Int Urol Nephrol. 2018 May;50(5):861-868. doi: 10.1007/s11255-018-1818-9. Epub 2018 Mar 9.
• [11] Gene expression profiles in peripheral lymphocytes by arsenic exposure and skin lesion status in a Bangladeshi population. Cancer Epidemiol Biomarkers Prev. 2006 Jul;15(7):1367-75. doi: 10.1158/1055-9965.EPI-06-0106.
• [12] Chronicity of dermal leishmaniasis caused by Leishmania panamensis is associated with parasite-mediated induction of chemokine gene expression.Infect Immun. 2014 Jul;82(7):2872-80. doi: 10.1128/IAI.01133-13. Epub 2014 Apr 21.
• [13] Tumor Necrosis Factor dynamically regulates the mRNA stabilome in rheumatoid arthritis fibroblast-like synoviocytes.PLoS One. 2017 Jul 14;12(7):e0179762. doi: 10.1371/journal.pone.0179762. eCollection 2017.
• [14] Gene expression and methylation profiles identified CXCL3 and CXCL8 as key genes for diagnosis and prognosis of colon adenocarcinoma.J Cell Physiol. 2020 May;235(5):4902-4912. doi: 10.1002/jcp.29368. Epub 2019 Nov 10.
• [15] Oncogenic KRAS Drives Immune Suppression in Colorectal Cancer.Cancer Cell. 2019 Apr 15;35(4):535-537. doi: 10.1016/j.ccell.2019.03.008.
• [16] Air pollution and humidity as triggering factors for stroke. Results of a 12-year analysis in the West Paris area.Rev Neurol (Paris). 2019 Dec;175(10):614-618. doi: 10.1016/j.neurol.2019.03.002. Epub 2019 Apr 25.
• [17] Baicalin Attenuates Subarachnoid Hemorrhagic Brain Injury by Modulating Blood-Brain Barrier Disruption, Inflammation, and Oxidative Damage in Mice.Oxid Med Cell Longev. 2017;2017:1401790. doi: 10.1155/2017/1401790. Epub 2017 Aug 24.
• [18] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [19] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [20] Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
• [21] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [22] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [23] ERE-independent ERalpha target genes differentially expressed in human breast tumors. Mol Cell Endocrinol. 2005 Dec 21;245(1-2):53-9. doi: 10.1016/j.mce.2005.10.003. Epub 2005 Nov 17.
• [24] Gene expression profiles in peripheral lymphocytes by arsenic exposure and skin lesion status in a Bangladeshi population. Cancer Epidemiol Biomarkers Prev. 2006 Jul;15(7):1367-75. doi: 10.1158/1055-9965.EPI-06-0106.
• [25] Considering temozolomide as a novel potential treatment for esophageal cancer. Cancer. 2011 May 1;117(9):2004-16. doi: 10.1002/cncr.25687. Epub 2010 Nov 8.
• [26] Identification of vitamin D3 target genes in human breast cancer tissue. J Steroid Biochem Mol Biol. 2016 Nov;164:90-97.
• [27] Global molecular effects of tocilizumab therapy in rheumatoid arthritis synovium. Arthritis Rheumatol. 2014 Jan;66(1):15-23.
• [28] Identification of mechanisms of action of bisphenol a-induced human preadipocyte differentiation by transcriptional profiling. Obesity (Silver Spring). 2014 Nov;22(11):2333-43.
• [29] Cannabidiol enhances cytotoxicity of anti-cancer drugs in human head and neck squamous cell carcinoma. Sci Rep. 2020 Nov 26;10(1):20622. doi: 10.1038/s41598-020-77674-y.
• [30] Antirheumatic drug response signatures in human chondrocytes: potential molecular targets to stimulate cartilage regeneration. Arthritis Res Ther. 2009;11(1):R15.
• [31] Gene expression profiling of breast cancer cells in response to gemcitabine: NF-kappaB pathway activation as a potential mechanism of resistance. Breast Cancer Res Treat. 2007 Apr;102(2):157-72.
• [32] Microarray analysis of bicalutamide action on telomerase activity, p53 pathway and viability of prostate carcinoma cell lines. J Pharm Pharmacol. 2005 Jan;57(1):83-92.
• [33] The transforming growth factor-beta family members bone morphogenetic protein-2 and macrophage inhibitory cytokine-1 as mediators of the antiangiogenic activity of N-(4-hydroxyphenyl)retinamide. Clin Cancer Res. 2005 Jun 15;11(12):4610-9.
• [34] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [35] Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
• [36] The genomic response of Ishikawa cells to bisphenol A exposure is dose- and time-dependent. Toxicology. 2010 Apr 11;270(2-3):137-49. doi: 10.1016/j.tox.2010.02.008. Epub 2010 Feb 17.
• [37] Transcriptome profile analysis of saturated aliphatic aldehydes reveals carbon number-specific molecules involved in pulmonary toxicity. Chem Res Toxicol. 2014 Aug 18;27(8):1362-70.
• [38] Comparison of the global gene expression profiles produced by methylparaben, n-butylparaben and 17beta-oestradiol in MCF7 human breast cancer cells. J Appl Toxicol. 2007 Jan-Feb;27(1):67-77. doi: 10.1002/jat.1200.
• [39] The contact allergen nickel triggers a unique inflammatory and proangiogenic gene expression pattern via activation of NF-kappaB and hypoxia-inducible factor-1alpha. J Immunol. 2007 Mar 1;178(5):3198-207.
• [40] Differential response of Mono Mac 6, BEAS-2B, and Jurkat cells to indoor dust. Environ Health Perspect. 2007 Sep;115(9):1325-32.
• [41] Gene expression profiling of human primary astrocytes exposed to manganese chloride indicates selective effects on several functions of the cells. Neurotoxicology. 2007 May;28(3):478-89.
• [42] Gene expression profile and cytotoxicity of human bronchial epithelial cells exposed to crotonaldehyde. Toxicol Lett. 2010 Aug 16;197(2):113-22.
• [43] Genomic analysis of pterostilbene predicts its antiproliferative effects against pancreatic cancer in vitro and in vivo. J Gastrointest Surg. 2012 Jun;16(6):1136-43. doi: 10.1007/s11605-012-1869-7. Epub 2012 Mar 27.