Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTTHFZMP)

• DOT Name: Fas-activated serine/threonine kinase (FASTK)
• Synonyms: FAST kinase; EC 2.7.11.1; EC 2.7.11.8
• Gene Name: FASTK
• Related Disease:
  Acute myocardial infarction
  Advanced cancer
  Anxiety
  Anxiety disorder
  Astrocytoma
  Atrial fibrillation
  Breast cancer
  Breast carcinoma
  Breast neoplasm
  Carcinoma of esophagus
  Cardiac failure
  Colorectal carcinoma
  Congestive heart failure
  Dementia
  Epilepsy
  Epithelial neoplasm
  Esophageal cancer
  Hemoglobin H disease
  Insulinoma
  Mitochondrial disease
  Neoplasm of esophagus
  Non-small-cell lung cancer
  Obstructive sleep apnea
  Papillon-Lefevre disease
  Pneumothorax
  Vibrio cholerae infection
  Stroke
  Coronary heart disease
  Lung adenocarcinoma
  Alpha thalassemia
  Bipolar disorder
  Drug-resistant tuberculosis
  Enterovirus infection
  Metastatic malignant neoplasm
  Multi-drug resistant tuberculosis
  Periodontitis
  Prostate cancer
  Prostate carcinoma
  Tuberculosis
• UniProt ID: FASTK_HUMAN
• EC Number: 2.7.11.1; 2.7.11.8
• Pfam ID: PF06743 ; PF08368 ; PF08373
• Sequence:
  MRRPRGEPGPRAPRPTEGATCAGPGESWSPSPNSMLRVLLSAQTSPARLSGLLLIPPVQP
  CCLGPSKWGDRPVGGGPSAGPVQGLQRLLEQAKSPGELLRWLGQNPSKVRAHHYSVALRR
  LGQLLGSRPRPPPVEQVTLQDLSQLIIRNCPSFDIHTIHVCLHLAVLLGFPSDGPLVCAL
  EQERRLRLPPKPPPPLQPLLRGGQGLEAALSCPRFLRYPRQHLISSLAEARPEELTPHVM
  VLLAQHLARHRLREPQLLEAIAHFLVVQETQLSSKVVQKLVLPFGRLNYLPLEQQFMPCL
  ERILAREAGVAPLATVNILMSLCQLRCLPFRALHFVFSPGFINYISGTPHALIVRRYLSL
  LDTAVELELPGYRGPRLPRRQQVPIFPQPLITDRARCKYSHKDIVAEGLRQLLGEEKYRQ
  DLTVPPGYCTDFLLCASSSGAVLPVRTQDPFLPYPPRSCPQGQAASSATTRDPAQRVVLV
  LRERWHFCRDGRVLLGSRALRERHLGLMGYQLLPLPFEELESQRGLPQLKSYLRQKLQAL
  GLRWGPEGG
• Function: Phosphorylates the splicing regulator TIA1, thereby promoting the inclusion of FAS exon 6, which leads to an mRNA encoding a pro-apoptotic form of the receptor; [Isoform 4]: Required for the biogenesis of some mitochondrial-encoded mRNAs, specifically stabilizes ND6 (NADH dehydrogenase complex subunit 6) mRNA, and regulates its levels.
• Tissue Specificity: Expressed in heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas.

Molecular Interaction Atlas (MIA) of This DOT

39 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Acute myocardial infarction	DISE3HTG	Strong	Genetic Variation	[1]
Advanced cancer	DISAT1Z9	Strong	Biomarker	[2]
Anxiety	DISIJDBA	Strong	Genetic Variation	[3]
Anxiety disorder	DISBI2BT	Strong	Genetic Variation	[3]
Astrocytoma	DISL3V18	Strong	Altered Expression	[4]
Atrial fibrillation	DIS15W6U	Strong	Genetic Variation	[5]
Breast cancer	DIS7DPX1	Strong	Biomarker	[6]
Breast carcinoma	DIS2UE88	Strong	Biomarker	[6]
Breast neoplasm	DISNGJLM	Strong	Altered Expression	[7]
Carcinoma of esophagus	DISS6G4D	Strong	Biomarker	[8]
Cardiac failure	DISDC067	Strong	Altered Expression	[9]
Colorectal carcinoma	DIS5PYL0	Strong	Biomarker	[10]
Congestive heart failure	DIS32MEA	Strong	Altered Expression	[9]
Dementia	DISXL1WY	Strong	Genetic Variation	[11]
Epilepsy	DISBB28L	Strong	Genetic Variation	[12]
Epithelial neoplasm	DIS0T594	Strong	Genetic Variation	[13]
Esophageal cancer	DISGB2VN	Strong	Biomarker	[8]
Hemoglobin H disease	DISHFWO5	Strong	Genetic Variation	[14]
Insulinoma	DISIU1JS	Strong	Biomarker	[15]
Mitochondrial disease	DISKAHA3	Strong	Biomarker	[16]
Neoplasm of esophagus	DISOLKAQ	Strong	Biomarker	[8]
Non-small-cell lung cancer	DIS5Y6R9	Strong	Biomarker	[17]
Obstructive sleep apnea	DIS0SVD1	Strong	Biomarker	[18]
Papillon-Lefevre disease	DIS3R7KX	Strong	Biomarker	[3]
Pneumothorax	DISP86H1	Strong	Genetic Variation	[19]
Vibrio cholerae infection	DISW7E3U	Strong	Biomarker	[20]
Stroke	DISX6UHX	moderate	Biomarker	[21]
Coronary heart disease	DIS5OIP1	Disputed	Altered Expression	[22]
Lung adenocarcinoma	DISD51WR	Disputed	Biomarker	[23]
Alpha thalassemia	DIS5XGK0	Limited	Biomarker	[24]
Bipolar disorder	DISAM7J2	Limited	Biomarker	[25]
Drug-resistant tuberculosis	DIS5BUFB	Limited	Biomarker	[26]
Enterovirus infection	DISH2UDP	Limited	Biomarker	[27]
Metastatic malignant neoplasm	DIS86UK6	Limited	Biomarker	[28]
Multi-drug resistant tuberculosis	DIS1A2CS	Limited	Biomarker	[26]
Periodontitis	DISI9JOI	Limited	Genetic Variation	[29]
Prostate cancer	DISF190Y	Limited	Biomarker	[30]
Prostate carcinoma	DISMJPLE	Limited	Biomarker	[30]
Tuberculosis	DIS2YIMD	Limited	Genetic Variation	[26]

16 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Fas-activated serine/threonine kinase (FASTK).	[31]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Fas-activated serine/threonine kinase (FASTK).	[32]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of Fas-activated serine/threonine kinase (FASTK).	[33]
Temozolomide	DMKECZD	Approved	Temozolomide decreases the expression of Fas-activated serine/threonine kinase (FASTK).	[34]
Testosterone	DM7HUNW	Approved	Testosterone increases the expression of Fas-activated serine/threonine kinase (FASTK).	[35]
Fluorouracil	DMUM7HZ	Approved	Fluorouracil decreases the expression of Fas-activated serine/threonine kinase (FASTK).	[36]
Folic acid	DMEMBJC	Approved	Folic acid decreases the expression of Fas-activated serine/threonine kinase (FASTK).	[37]
Isotretinoin	DM4QTBN	Approved	Isotretinoin decreases the expression of Fas-activated serine/threonine kinase (FASTK).	[31]
Bortezomib	DMNO38U	Approved	Bortezomib decreases the expression of Fas-activated serine/threonine kinase (FASTK).	[38]
Testosterone enanthate	DMB6871	Approved	Testosterone enanthate affects the expression of Fas-activated serine/threonine kinase (FASTK).	[39]
Menthol	DMG2KW7	Approved	Menthol decreases the expression of Fas-activated serine/threonine kinase (FASTK).	[40]
Alitretinoin	DMME8LH	Approved	Alitretinoin decreases the expression of Fas-activated serine/threonine kinase (FASTK).	[31]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of Fas-activated serine/threonine kinase (FASTK).	[42]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde increases the expression of Fas-activated serine/threonine kinase (FASTK).	[43]
4-hydroxy-2-nonenal	DM2LJFZ	Investigative	4-hydroxy-2-nonenal decreases the expression of Fas-activated serine/threonine kinase (FASTK).	[44]
all-trans-4-oxo-retinoic acid	DMM2R1N	Investigative	all-trans-4-oxo-retinoic acid decreases the expression of Fas-activated serine/threonine kinase (FASTK).	[31]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Fas-activated serine/threonine kinase (FASTK).	[41]

References

• [1] Appropriate secondary prevention and clinical outcomes after acute myocardial infarction according to atherothrombotic risk stratification: The FAST-MI 2010 registry.Eur J Prev Cardiol. 2019 Mar;26(4):411-419. doi: 10.1177/2047487318808638. Epub 2018 Oct 24.
• [2] An Oncolytic Adenovirus Vector Expressing p14 FAST Protein Induces Widespread Syncytium Formation and Reduces Tumor Growth Rate InVivo.Mol Ther Oncolytics. 2019 May 15;14:107-120. doi: 10.1016/j.omto.2019.05.001. eCollection 2019 Sep 27.
• [3] Preoperative Carbohydrate Loading in Gynecological Patients Undergoing Combined Spinal and Epidural Anesthesia.J Invest Surg. 2020 Aug;33(7):587-595. doi: 10.1080/08941939.2018.1546352. Epub 2019 Jan 15.
• [4] miR-106a-5p inhibits the proliferation and migration of astrocytoma cells and promotes apoptosis by targeting FASTK.PLoS One. 2013 Aug 27;8(8):e72390. doi: 10.1371/journal.pone.0072390. eCollection 2013.
• [5] Thoracoscopic vs. catheter ablation for atrial fibrillation: long-term follow-up of the FAST randomized trial.Europace. 2019 May 1;21(5):746-753. doi: 10.1093/europace/euy325.
• [6] PHF5A Epigenetically Inhibits Apoptosis to Promote Breast Cancer Progression.Cancer Res. 2018 Jun 15;78(12):3190-3206. doi: 10.1158/0008-5472.CAN-17-3514. Epub 2018 Apr 26.
• [7] Reovirus FAST Protein Enhances Vesicular Stomatitis Virus Oncolytic Virotherapy in Primary and Metastatic Tumor Models.Mol Ther Oncolytics. 2017 Aug 4;6:80-89. doi: 10.1016/j.omto.2017.08.001. eCollection 2017 Sep 15.
• [8] Automatic treatment planning facilitates fast generation of high-quality treatment plans for esophageal cancer.Acta Oncol. 2017 Nov;56(11):1495-1500. doi: 10.1080/0284186X.2017.1349928. Epub 2017 Aug 25.
• [9] Myocardial gene expression of matched hibernating and control tissue from patients with ischemic left ventricular dysfunction.Heart Vessels. 2008 Jul;23(4):230-42. doi: 10.1007/s00380-007-1035-4. Epub 2008 Jul 23.
• [10] The fecal hemoglobin concentration, age and sex test score: Development and external validation of a simple prediction tool for colorectal cancer detection in symptomatic patients.Int J Cancer. 2017 May 15;140(10):2201-2211. doi: 10.1002/ijc.30639. Epub 2017 Mar 6.
• [11] The Changing Profile of Patients in a Geriatric Medicine Led Memory Clinic over 12 Years.J Nutr Health Aging. 2019;23(3):310-315. doi: 10.1007/s12603-019-1161-6.
• [12] An animal model of genetic predisposition to develop acquired epileptogenesis: The FAST and SLOW rats.Epilepsia. 2019 Oct;60(10):2023-2036. doi: 10.1111/epi.16329. Epub 2019 Aug 29.
• [13] Ultrabright fluorescent silica nanoparticles for in vivo targeting of xenografted human tumors and cancer cells in zebrafish.Nanoscale. 2019 Nov 28;11(46):22316-22327. doi: 10.1039/c9nr06371d.
• [14] Relationship between neonatal screening results by HPLC and the number of -thalassaemia gene mutations; consequences for the cut-off value.J Med Screen. 2011;18(4):182-6. doi: 10.1258/jms.2011.011043.
• [15] ANTHROPOMETRIC FEATURES ARE NOT PREDICTIVE OF 72-HOUR FAST DURATION IN INSULINOMAS.Endocr Pract. 2017 Aug;23(8):923-928. doi: 10.4158/EP171872.OR. Epub 2017 Jun 14.
• [16] FASTKD1 and FASTKD4 have opposite effects on expression of specific mitochondrial RNAs, depending upon their endonuclease-like RAP domain.Nucleic Acids Res. 2017 Jun 2;45(10):6135-6146. doi: 10.1093/nar/gkx164.
• [17] ERCC1/BRCA1 expression and gene polymorphisms as prognostic and predictive factors in advanced NSCLC treated with or without cisplatin.Br J Cancer. 2013 Apr 30;108(8):1695-703. doi: 10.1038/bjc.2013.127. Epub 2013 Apr 2.
• [18] Evaluation of adiponectin profile in Italian patients affected by obstructive sleep apnea syndrome.Pulm Pharmacol Ther. 2016 Oct;40:104-8. doi: 10.1016/j.pupt.2016.07.008. Epub 2016 Jul 25.
• [19] The ABCDs of ResUS - Resuscitation Ultrasound.Cureus. 2019 May 7;11(5):e4616. doi: 10.7759/cureus.4616.
• [20] Anatomic Evidence for Information Exchange between Primary Afferent Sensory Neurons Innervating the Anterior Eye Chamber and the Dura Mater in Rat.Invest Ophthalmol Vis Sci. 2018 Jul 2;59(8):3424-3430. doi: 10.1167/iovs.18-24308.
• [21] Mechanical Revascularization in the Era of the Field Assessment Stroke Triage for Emergency Destination (FAST-ED): A Retrospective Cohort Assessment in a Community Stroke Practice.J Stroke Cerebrovasc Dis. 2020 Jan;29(1):104472. doi: 10.1016/j.jstrokecerebrovasdis.2019.104472. Epub 2019 Nov 4.
• [22] MicroRNA-20a participates in the aerobic exercise-based prevention of coronary artery disease by targeting PTEN.Biomed Pharmacother. 2017 Nov;95:756-763. doi: 10.1016/j.biopha.2017.08.086. Epub 2017 Sep 8.
• [23] Adenovirus-Mediated Expression of the p14 Fusion-Associated Small Transmembrane Protein Promotes Cancer Cell Fusion and Apoptosis In Vitro but Does Not Provide Therapeutic Efficacy in a Xenograft Mouse Model of Cancer.PLoS One. 2016 Mar 17;11(3):e0151516. doi: 10.1371/journal.pone.0151516. eCollection 2016.
• [24] Newborn screening for haemoglobinopathies by high performance liquid chromatography (HPLC): diagnostic utility of different approaches in resource-poor settings.Clin Chem Lab Med. 2014 Dec;52(12):1791-6. doi: 10.1515/cclm-2014-0452.
• [25] Psychometric properties of the well-being index (WHO-5) spanish version in a sample of euthymic patients with bipolar disorder.J Affect Disord. 2018 Mar 1;228:153-159. doi: 10.1016/j.jad.2017.12.006. Epub 2017 Dec 6.
• [26] Turning Off the Tap: Using the FAST Approach to Stop the Spread of Drug-Resistant Tuberculosis in the Russian Federation.J Infect Dis. 2018 Jul 13;218(4):654-658. doi: 10.1093/infdis/jiy190.
• [27] Comparison of Luminex NxTAG Respiratory Pathogen Panel and xTAG Respiratory Viral Panel FAST Version 2 for the Detection of Respiratory Viruses.Ann Lab Med. 2017 May;37(3):267-271. doi: 10.3343/alm.2017.37.3.267.
• [28] Comparison of Claudin 18.2 expression in primary tumors and lymph node metastases in Japanese patients with gastric adenocarcinoma.Jpn J Clin Oncol. 2019 Sep 1;49(9):870-876. doi: 10.1093/jjco/hyz068.
• [29] Genomewide Association Study Identifies Cxcl Family Members as Partial Mediators of LPS-Induced Periodontitis.J Bone Miner Res. 2018 Aug;33(8):1450-1463. doi: 10.1002/jbmr.3440. Epub 2018 May 22.
• [30] Fas Activated Serine-Threonine Kinase Domains 2 (FASTKD2) mediates apoptosis of breast and prostate cancer cells through its novel FAST2 domain.BMC Cancer. 2014 Nov 20;14:852. doi: 10.1186/1471-2407-14-852.
• [31] Retinoic acid and its 4-oxo metabolites are functionally active in human skin cells in vitro. J Invest Dermatol. 2005 Jul;125(1):143-53.
• [32] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [33] Apoptosis-related mRNA expression profiles of ovarian cancer cell lines following cisplatin treatment. J Gynecol Oncol. 2010 Dec 30;21(4):255-61. doi: 10.3802/jgo.2010.21.4.255. Epub 2010 Dec 31.
• [34] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [35] The exosome-like vesicles derived from androgen exposed-prostate stromal cells promote epithelial cells proliferation and epithelial-mesenchymal transition. Toxicol Appl Pharmacol. 2021 Jan 15;411:115384. doi: 10.1016/j.taap.2020.115384. Epub 2020 Dec 25.
• [36] New insights into the mechanisms underlying 5-fluorouracil-induced intestinal toxicity based on transcriptomic and metabolomic responses in human intestinal organoids. Arch Toxicol. 2021 Aug;95(8):2691-2718. doi: 10.1007/s00204-021-03092-2. Epub 2021 Jun 20.
• [37] Folic acid supplementation dysregulates gene expression in lymphoblastoid cells--implications in nutrition. Biochem Biophys Res Commun. 2011 Sep 9;412(4):688-92. doi: 10.1016/j.bbrc.2011.08.027. Epub 2011 Aug 16.
• [38] The proapoptotic effect of zoledronic acid is independent of either the bone microenvironment or the intrinsic resistance to bortezomib of myeloma cells and is enhanced by the combination with arsenic trioxide. Exp Hematol. 2011 Jan;39(1):55-65.
• [39] Transcriptional profiling of testosterone-regulated genes in the skeletal muscle of human immunodeficiency virus-infected men experiencing weight loss. J Clin Endocrinol Metab. 2007 Jul;92(7):2793-802. doi: 10.1210/jc.2006-2722. Epub 2007 Apr 17.
• [40] Repurposing L-menthol for systems medicine and cancer therapeutics? L-menthol induces apoptosis through caspase 10 and by suppressing HSP90. OMICS. 2016 Jan;20(1):53-64.
• [41] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [42] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [43] Identification of formaldehyde-responsive genes by suppression subtractive hybridization. Toxicology. 2008 Jan 14;243(1-2):224-35.
• [44] Microarray analysis of H2O2-, HNE-, or tBH-treated ARPE-19 cells. Free Radic Biol Med. 2002 Nov 15;33(10):1419-32.