Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTWFFOVH)

• DOT Name: Nuclear transcription factor Y subunit alpha (NFYA)
• Synonyms: CAAT box DNA-binding protein subunit A; Nuclear transcription factor Y subunit A; NF-YA
• Gene Name: NFYA
• Related Disease:
  Adult respiratory distress syndrome
  Advanced cancer
  Breast cancer
  Breast carcinoma
  Dengue
  Endometrial cancer
  Endometrial carcinoma
  Fibrolamellar liver cancer
  Haemophilia A
  Hemophilia
  Herpes simplex infection
  High blood pressure
  Laurin-Sandrow syndrome
  Lung carcinoma
  Lung neoplasm
  Multiple sclerosis
  Neoplasm
  Nephropathy
  Non-insulin dependent diabetes
  Obesity
  Rheumatoid arthritis
  Acute myelogenous leukaemia
  Head-neck squamous cell carcinoma
  Adenocarcinoma
  Lung cancer
  Primary biliary cholangitis
  Chronic pancreatitis
  Epithelial ovarian cancer
  Essential hypertension
  Malaria
  Neuroblastoma
  Pancreatic cancer
  Periodontitis
• UniProt ID: NFYA_HUMAN
• PDB ID: 4AWL; 6QMP; 6QMQ; 6QMS
• Pfam ID: PF02045
• Sequence:
  MEQYTANSNSSTEQIVVQAGQIQQQQQGGVTAVQLQTEAQVASASGQQVQTLQVVQGQPL
  MVQVSGGQLITSTGQPIMVQAVPGGQGQTIMQVPVSGTQGLQQIQLVPPGQIQIQGGQAV
  QVQGQQGQTQQIIIQQPQTAVTAGQTQTQQQIAVQGQQVAQTAEGQTIVYQPVNADGTIL
  QQVTVPVSGMITIPAASLAGAQIVQTGANTNTTSSGQGTVTVTLPVAGNVVNSGGMVMMV
  PGAGSVPAIQRIPLPGAEMLEEEPLYVNAKQYHRILKRRQARAKLEAEGKIPKERRKYLH
  ESRHRHAMARKRGEGGRFFSPKEKDSPHMQDPNQADEEAMTQIIRVS
• Function: Component of the sequence-specific heterotrimeric transcription factor (NF-Y) which specifically recognizes a 5'-CCAAT-3' box motif found in the promoters of its target genes. NF-Y can function as both an activator and a repressor, depending on its interacting cofactors. NF-YA positively regulates the transcription of the core clock component BMAL1.
• KEGG Pathway:
  Antigen processing and presentation (hsa04612)
  Spinocerebellar ataxia (hsa05017)
  Tuberculosis (hsa05152)
• Reactome Pathway:
  Activation of gene expression by SREBF (SREBP) (R-HSA-2426168)
  ATF4 activates genes in response to endoplasmic reticulum stress (R-HSA-380994)
  ATF6 (ATF6-alpha) activates chaperone genes (R-HSA-381183)
  FOXO-mediated transcription of cell death genes (R-HSA-9614657)
  PPARA activates gene expression (R-HSA-1989781)

Molecular Interaction Atlas (MIA) of This DOT

33 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Adult respiratory distress syndrome	DISIJV47	Strong	Genetic Variation	[1]
Advanced cancer	DISAT1Z9	Strong	Altered Expression	[2]
Breast cancer	DIS7DPX1	Strong	Biomarker	[3]
Breast carcinoma	DIS2UE88	Strong	Biomarker	[3]
Dengue	DISKH221	Strong	Biomarker	[4]
Endometrial cancer	DISW0LMR	Strong	Biomarker	[5]
Endometrial carcinoma	DISXR5CY	Strong	Biomarker	[5]
Fibrolamellar liver cancer	DISUDA2P	Strong	Altered Expression	[6]
Haemophilia A	DIS0RQ2E	Strong	Genetic Variation	[7]
Hemophilia	DIS1S8P6	Strong	Genetic Variation	[7]
Herpes simplex infection	DISL1SAV	Strong	Altered Expression	[8]
High blood pressure	DISY2OHH	Strong	Altered Expression	[9]
Laurin-Sandrow syndrome	DISOYBC3	Strong	Genetic Variation	[10]
Lung carcinoma	DISTR26C	Strong	Altered Expression	[11]
Lung neoplasm	DISVARNB	Strong	Biomarker	[12]
Multiple sclerosis	DISB2WZI	Strong	Biomarker	[13]
Neoplasm	DISZKGEW	Strong	Altered Expression	[2]
Nephropathy	DISXWP4P	Strong	Altered Expression	[14]
Non-insulin dependent diabetes	DISK1O5Z	Strong	Genetic Variation	[15]
Obesity	DIS47Y1K	Strong	Altered Expression	[16]
Rheumatoid arthritis	DISTSB4J	Strong	Biomarker	[17]
Acute myelogenous leukaemia	DISCSPTN	moderate	Genetic Variation	[18]
Head-neck squamous cell carcinoma	DISF7P24	moderate	Biomarker	[19]
Adenocarcinoma	DIS3IHTY	Disputed	Altered Expression	[20]
Lung cancer	DISCM4YA	Disputed	Altered Expression	[11]
Primary biliary cholangitis	DIS43E0O	Disputed	Biomarker	[21]
Chronic pancreatitis	DISBUOMJ	Limited	Genetic Variation	[22]
Epithelial ovarian cancer	DIS56MH2	Limited	Altered Expression	[23]
Essential hypertension	DIS7WI98	Limited	Genetic Variation	[24]
Malaria	DISQ9Y50	Limited	Biomarker	[25]
Neuroblastoma	DISVZBI4	Limited	Biomarker	[26]
Pancreatic cancer	DISJC981	Limited	Genetic Variation	[22]
Periodontitis	DISI9JOI	Limited	Genetic Variation	[27]

18 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Nuclear transcription factor Y subunit alpha (NFYA).	[28]
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Nuclear transcription factor Y subunit alpha (NFYA).	[29]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Nuclear transcription factor Y subunit alpha (NFYA).	[30]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Nuclear transcription factor Y subunit alpha (NFYA).	[31]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of Nuclear transcription factor Y subunit alpha (NFYA).	[32]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of Nuclear transcription factor Y subunit alpha (NFYA).	[33]
Vorinostat	DMWMPD4	Approved	Vorinostat increases the expression of Nuclear transcription factor Y subunit alpha (NFYA).	[35]
Demecolcine	DMCZQGK	Approved	Demecolcine increases the expression of Nuclear transcription factor Y subunit alpha (NFYA).	[36]
Sodium lauryl sulfate	DMLJ634	Approved	Sodium lauryl sulfate increases the expression of Nuclear transcription factor Y subunit alpha (NFYA).	[37]
Mitomycin	DMH0ZJE	Approved	Mitomycin increases the expression of Nuclear transcription factor Y subunit alpha (NFYA).	[38]
Rifampicin	DM5DSFZ	Approved	Rifampicin decreases the expression of Nuclear transcription factor Y subunit alpha (NFYA).	[39]
Urethane	DM7NSI0	Phase 4	Urethane increases the expression of Nuclear transcription factor Y subunit alpha (NFYA).	[40]
Curcumin	DMQPH29	Phase 3	Curcumin decreases the expression of Nuclear transcription factor Y subunit alpha (NFYA).	[41]
Phenol	DM1QSM3	Phase 2/3	Phenol increases the expression of Nuclear transcription factor Y subunit alpha (NFYA).	[42]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the expression of Nuclear transcription factor Y subunit alpha (NFYA).	[43]
Leflunomide	DMR8ONJ	Phase 1 Trial	Leflunomide decreases the expression of Nuclear transcription factor Y subunit alpha (NFYA).	[44]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde decreases the expression of Nuclear transcription factor Y subunit alpha (NFYA).	[46]
Nickel chloride	DMI12Y8	Investigative	Nickel chloride increases the expression of Nuclear transcription factor Y subunit alpha (NFYA).	[42]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Arsenic	DMTL2Y1	Approved	Arsenic affects the methylation of Nuclear transcription factor Y subunit alpha (NFYA).	[34]
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 decreases the phosphorylation of Nuclear transcription factor Y subunit alpha (NFYA).	[45]

References

• [1] Genetic polymorphisms of peptidase inhibitor 3 (elafin) are associated with acute respiratory distress syndrome.Am J Respir Cell Mol Biol. 2009 Dec;41(6):696-704. doi: 10.1165/rcmb.2008-0410OC. Epub 2009 Feb 27.
• [2] NF-YA overexpression protects from glutamine deprivation.Biochim Biophys Acta Mol Cell Res. 2020 Feb;1867(2):118571. doi: 10.1016/j.bbamcr.2019.118571. Epub 2019 Nov 9.
• [3] Overexpression and alternative splicing of NF-YA in breast cancer.Sci Rep. 2019 Sep 10;9(1):12955. doi: 10.1038/s41598-019-49297-5.
• [4] What Came First-the Virus or the Egg?.Cell. 2017 Feb 23;168(5):755-757. doi: 10.1016/j.cell.2017.02.012.
• [5] Prognostic role of NF-YA splicing isoforms and Lamin A status in low grade endometrial cancer.Oncotarget. 2017 Jan 31;8(5):7935-7945. doi: 10.18632/oncotarget.13854.
• [6] Transcriptional regulation of the ferritin heavy-chain gene: the activity of the CCAAT binding factor NF-Y is modulated in heme-treated Friend leukemia cells and during monocyte-to-macrophage differentiation.Mol Cell Biol. 1997 Mar;17(3):1387-95. doi: 10.1128/MCB.17.3.1387.
• [7] Polymorphisms in the TNFA gene and the risk of inhibitor development in patients with hemophilia A.Blood. 2006 Dec 1;108(12):3739-45. doi: 10.1182/blood-2006-05-024711. Epub 2006 Aug 22.
• [8] Engineering an improved cell cycle-regulatable herpes simplex virus type 1 amplicon vector with enhanced transgene expression in proliferating cells yet attenuated activities in resting cells.Hum Gene Ther. 2007 Mar;18(3):222-31. doi: 10.1089/hum.2006.140.
• [9] A polymorphism in intron I of the human angiotensinogen gene (hAGT) affects binding by HNF3 and hAGT expression and increases blood pressure in mice.J Biol Chem. 2019 Aug 2;294(31):11829-11839. doi: 10.1074/jbc.RA119.007715. Epub 2019 Jun 14.
• [10] A haplotype at the COL9A2 gene locus contributes to the genetic risk for lumbar spinal stenosis in the Korean population.Spine (Phila Pa 1976). 2011 Jul 15;36(16):1273-8. doi: 10.1097/BRS.0b013e31820e6282.
• [11] NF-YA Overexpression in Lung Cancer: LUSC.Genes (Basel). 2019 Nov 17;10(11):937. doi: 10.3390/genes10110937.
• [12] Codon 12 region of mouse K-ras gene is the site for in vitro binding of transcription factors GATA-6 and NF-Y.Biochemistry (Mosc). 2005 Oct;70(10):1180-4. doi: 10.1007/s10541-005-0244-7.
• [13] IL7R expression and upregulation by IFN in dendritic cell subsets is haplotype-dependent.PLoS One. 2013 Oct 16;8(10):e77508. doi: 10.1371/journal.pone.0077508. eCollection 2013.
• [14] Age-Related Expression of Human AT1R Variants and Associated Renal Dysfunction in Transgenic Mice.Am J Hypertens. 2018 Oct 15;31(11):1234-1242. doi: 10.1093/ajh/hpy121.
• [15] Effects of Genetic Variants of Nuclear Receptor Y on the Risk of Type 2 Diabetes Mellitus.J Diabetes Res. 2019 May 7;2019:4902301. doi: 10.1155/2019/4902301. eCollection 2019.
• [16] Obesity-induced endoplasmic reticulum stress suppresses nuclear factor-Y expression.Mol Cell Biochem. 2017 Feb;426(1-2):47-54. doi: 10.1007/s11010-016-2879-7. Epub 2016 Nov 12.
• [17] Identification of transcription regulatory relationships in rheumatoid arthritis and osteoarthritis.Clin Rheumatol. 2013 May;32(5):609-15. doi: 10.1007/s10067-012-2143-9. Epub 2013 Jan 8.
• [18] Genome-wide haplotype association study identify the FGFR2 gene as a risk gene for acute myeloid leukemia.Oncotarget. 2017 Jan 31;8(5):7891-7899. doi: 10.18632/oncotarget.13631.
• [19] p53-targeted lincRNA-p21 acts as a tumor suppressor by inhibiting JAK2/STAT3 signaling pathways in head and neck squamous cell carcinoma.Mol Cancer. 2019 Mar 11;18(1):38. doi: 10.1186/s12943-019-0993-3.
• [20] Upregulation of annexin A1 expression by butyrate in human colon adenocarcinoma cells: role of p53, NF-Y, and p38 mitogen-activated protein kinase.Mol Cell Biol. 2008 Aug;28(15):4665-74. doi: 10.1128/MCB.00650-07. Epub 2008 Jun 9.
• [21] Single-nucleotide polymorphism analysis of the multidrug resistance protein 3 gene for the detection of clinical progression in Japanese patients with primary biliary cirrhosis.Hepatology. 2008 Sep;48(3):853-62. doi: 10.1002/hep.22382.
• [22] Significance of MUC2 gene methylation detection in pancreatic cancer diagnosis.Pancreatology. 2019 Dec;19(8):1049-1053. doi: 10.1016/j.pan.2019.09.012. Epub 2019 Sep 27.
• [23] NF-YA underlies EZH2 upregulation and is essential for proliferation of human epithelial ovarian cancer cells.Mol Cancer Res. 2013 Apr;11(4):360-9. doi: 10.1158/1541-7786.MCR-12-0661. Epub 2013 Jan 29.
• [24] Novel genetic variation in exon 28 of FBN1 gene is associated with essential hypertension.Am J Hypertens. 2011 Jun;24(6):687-93. doi: 10.1038/ajh.2011.21. Epub 2011 Feb 17.
• [25] Transient Expression of Plasmodium berghei MSP8 and HAP2 in the Marine Protozoan Parasite Perkinsus marinus.J Parasitol. 2017 Feb;103(1):118-122. doi: 10.1645/16-88. Epub 2016 Oct 10.
• [26] Discovery, characterization and potential roles of a novel NF-YAx splice variant in human neuroblastoma.J Exp Clin Cancer Res. 2019 Dec 5;38(1):482. doi: 10.1186/s13046-019-1481-8.
• [27] The ATC/TTC haplotype in the Interleukin 8 gene in response to Gram-negative bacteria: A pilot study.Arch Oral Biol. 2019 Nov;107:104508. doi: 10.1016/j.archoralbio.2019.104508. Epub 2019 Jul 24.
• [28] Stem cell transcriptome responses and corresponding biomarkers that indicate the transition from adaptive responses to cytotoxicity. Chem Res Toxicol. 2017 Apr 17;30(4):905-922.
• [29] Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
• [30] Phenotypic characterization of retinoic acid differentiated SH-SY5Y cells by transcriptional profiling. PLoS One. 2013 May 28;8(5):e63862.
• [31] Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
• [32] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [33] Phosphorylated TP63 induces transcription of RPN13, leading to NOS2 protein degradation. J Biol Chem. 2010 Dec 31;285(53):41422-31. doi: 10.1074/jbc.M110.158642. Epub 2010 Oct 19.
• [34] Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
• [35] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [36] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
• [37] CXCL14 downregulation in human keratinocytes is a potential biomarker for a novel in vitro skin sensitization test. Toxicol Appl Pharmacol. 2020 Jan 1;386:114828. doi: 10.1016/j.taap.2019.114828. Epub 2019 Nov 14.
• [38] Genomic and proteomic profiling of responses to toxic metals in human lung cells. Environ Health Perspect. 2003 May;111(6):825-35.
• [39] Integrated analysis of rifampicin-induced microRNA and gene expression changes in human hepatocytes. Drug Metab Pharmacokinet. 2014;29(4):333-40.
• [40] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [41] Gene expression profiling identifies activating transcription factor 3 as a novel contributor to the proapoptotic effect of curcumin. Mol Cancer Ther. 2005 Feb;4(2):233-41.
• [42] Classification of heavy-metal toxicity by human DNA microarray analysis. Environ Sci Technol. 2007 May 15;41(10):3769-74.
• [43] Transcriptional signature of human macrophages exposed to the environmental contaminant benzo(a)pyrene. Toxicol Sci. 2010 Apr;114(2):247-59.
• [44] Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
• [45] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [46] Gene expression changes in primary human nasal epithelial cells exposed to formaldehyde in vitro. Toxicol Lett. 2010 Oct 5;198(2):289-95.