General Information of Drug Off-Target (DOT) (ID: OTX3GUHB)

DOT Name Cortistatin (CORT)
Gene Name CORT
Related Disease
Arthritis ( )
Cognitive impairment ( )
Abdominal aortic aneurysm ( )
Acute myocardial infarction ( )
Arteriosclerosis ( )
Atherosclerosis ( )
Autoimmune disease ( )
Behcet disease ( )
Breast cancer ( )
Breast carcinoma ( )
Cardiovascular disease ( )
Cyclic hematopoiesis ( )
Diabetic retinopathy ( )
Hepatocellular carcinoma ( )
Major depressive disorder ( )
Mixed anxiety and depressive disorder ( )
Neoplasm ( )
Obesity ( )
Type-1/2 diabetes ( )
Adrenocortical insufficiency ( )
Neuroblastoma ( )
Acute myelogenous leukaemia ( )
Asthma ( )
Advanced cancer ( )
Anxiety ( )
Anxiety disorder ( )
Colitis ( )
Coronary atherosclerosis ( )
Coronary heart disease ( )
Depression ( )
Non-insulin dependent diabetes ( )
Osteoarthritis ( )
Post-traumatic stress disorder ( )
Schizophrenia ( )
Vascular disease ( )
UniProt ID
CORT_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
7S8L; 7S8M; 7VDL; 7VV4
Pfam ID
PF03002
Sequence
MPLSPGLLLLLLSGATATAALPLEGGPTGRDSEHMQEAAGIRKSSLLTFLAWWFEWTSQA
SAGPLIGEEAREVARRQEGAPPQQSARRDRMPCRNFFWKTFSSCK
Function Binds to all human somatostatin receptor (SSTR) subtypes. It also inhibits cAMP production induced by forskolin through SSTRs.
Tissue Specificity Expressed in a subset of GABAergic cells in the cortex and hippocampus.
KEGG Pathway
Neuroactive ligand-receptor interaction (hsa04080 )
Reactome Pathway
G alpha (i) signalling events (R-HSA-418594 )
Peptide ligand-binding receptors (R-HSA-375276 )

Molecular Interaction Atlas (MIA) of This DOT

35 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Arthritis DIST1YEL Definitive Biomarker [1]
Cognitive impairment DISH2ERD Definitive Altered Expression [2]
Abdominal aortic aneurysm DISD06OF Strong Biomarker [3]
Acute myocardial infarction DISE3HTG Strong Biomarker [4]
Arteriosclerosis DISK5QGC Strong Biomarker [5]
Atherosclerosis DISMN9J3 Strong Biomarker [5]
Autoimmune disease DISORMTM Strong Altered Expression [5]
Behcet disease DISSYMBS Strong Biomarker [6]
Breast cancer DIS7DPX1 Strong Biomarker [7]
Breast carcinoma DIS2UE88 Strong Biomarker [7]
Cardiovascular disease DIS2IQDX Strong Biomarker [8]
Cyclic hematopoiesis DISQQOM4 Strong Altered Expression [9]
Diabetic retinopathy DISHGUJM Strong Altered Expression [10]
Hepatocellular carcinoma DIS0J828 Strong Altered Expression [11]
Major depressive disorder DIS4CL3X Strong Biomarker [12]
Mixed anxiety and depressive disorder DISV809X Strong Biomarker [13]
Neoplasm DISZKGEW Strong Altered Expression [14]
Obesity DIS47Y1K Strong Biomarker [7]
Type-1/2 diabetes DISIUHAP Strong Altered Expression [10]
Adrenocortical insufficiency DISZ0CPT moderate Biomarker [15]
Neuroblastoma DISVZBI4 moderate Genetic Variation [16]
Acute myelogenous leukaemia DISCSPTN Disputed Genetic Variation [17]
Asthma DISW9QNS Disputed Posttranslational Modification [18]
Advanced cancer DISAT1Z9 Limited Biomarker [14]
Anxiety DISIJDBA Limited Biomarker [19]
Anxiety disorder DISBI2BT Limited Biomarker [19]
Colitis DISAF7DD Limited Altered Expression [20]
Coronary atherosclerosis DISKNDYU Limited Biomarker [21]
Coronary heart disease DIS5OIP1 Limited Biomarker [21]
Depression DIS3XJ69 Limited Altered Expression [22]
Non-insulin dependent diabetes DISK1O5Z Limited Altered Expression [23]
Osteoarthritis DIS05URM Limited Biomarker [24]
Post-traumatic stress disorder DISHL1EY Limited Biomarker [25]
Schizophrenia DISSRV2N Limited Altered Expression [25]
Vascular disease DISVS67S Limited Biomarker [21]
------------------------------------------------------------------------------------
⏷ Show the Full List of 35 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
2 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate decreases the expression of Cortistatin (CORT). [26]
PMID28460551-Compound-2 DM4DOUB Patented PMID28460551-Compound-2 increases the expression of Cortistatin (CORT). [28]
------------------------------------------------------------------------------------
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene affects the methylation of Cortistatin (CORT). [27]
------------------------------------------------------------------------------------

References

1 Berberine ameliorates collagen-induced arthritis in rats by suppressing Th17 cell responses via inducing cortistatin in the gut.FEBS J. 2017 Sep;284(17):2786-2801. doi: 10.1111/febs.14147. Epub 2017 Jul 14.
2 Targeting glucocorticoid receptors prevents the effects of early life stress on amyloid pathology and cognitive performance in APP/PS1 mice.Transl Psychiatry. 2018 Mar 1;8(1):53. doi: 10.1038/s41398-018-0101-2.
3 Cortistatin attenuates angiotensin II-induced abdominal aortic aneurysm through inactivation of the ERK1/2 signaling pathways.Biochem Biophys Res Commun. 2018 Jan 8;495(2):1801-1806. doi: 10.1016/j.bbrc.2017.12.033. Epub 2017 Dec 7.
4 Cortistatin Improves Cardiac Function After Acute Myocardial Infarction in Rats by Suppressing Myocardial Apoptosis and Endoplasmic Reticulum Stress.J Cardiovasc Pharmacol Ther. 2017 Jan;22(1):83-93. doi: 10.1177/1074248416644988. Epub 2016 Jun 23.
5 Cortistatin reduces atherosclerosis in hyperlipidemic ApoE-deficient mice and the formation of foam cells.Sci Rep. 2017 Apr 13;7:46444. doi: 10.1038/srep46444.
6 Serum Cortistatin Levels in Patients with Ocular Active and Ocular Inactive Behet Disease.Ocul Immunol Inflamm. 2020 May 18;28(4):601-605. doi: 10.1080/09273948.2019.1610461. Epub 2019 Jul 17.
7 Lack of cortistatin or somatostatin differentially influences DMBA-induced mammary gland tumorigenesis in mice in an obesity-dependent mode.Breast Cancer Res. 2016 Mar 8;18(1):29. doi: 10.1186/s13058-016-0689-1.
8 Cortistatin exerts antiproliferation and antimigration effects in vascular smooth muscle cells stimulated by Ang II through suppressing ERK1/2, p38 MAPK, JNK and ERK5 signaling pathways.Ann Transl Med. 2019 Oct;7(20):561. doi: 10.21037/atm.2019.09.45.
9 17-Estradiol is required for the sexually dimorphic effects of repeated binge-pattern alcohol exposure on the HPA axis during adolescence.PLoS One. 2012;7(2):e32263. doi: 10.1371/journal.pone.0032263. Epub 2012 Feb 22.
10 Evaluation of aqueous humor and serum cortistatin levels in diabetic patients with and without diabetic retinopathy.Eur J Ophthalmol. 2021 Mar;31(2):638-642. doi: 10.1177/1120672119894847. Epub 2019 Dec 10.
11 Cortistatin production by HepG2 human hepatocellular carcinoma cell line and distribution of somatostatin receptors.J Hepatol. 2004 May;40(5):792-8. doi: 10.1016/j.jhep.2004.01.016.
12 Molecular evidence for BDNF- and GABA-related dysfunctions in the amygdala of female subjects with major depression.Mol Psychiatry. 2012 Nov;17(11):1130-42. doi: 10.1038/mp.2011.113. Epub 2011 Sep 13.
13 Differential Peripheral Proteomic Biosignature of Fluoxetine Response in a Mouse Model of Anxiety/Depression.Front Cell Neurosci. 2017 Aug 16;11:237. doi: 10.3389/fncel.2017.00237. eCollection 2017.
14 The components of somatostatin and ghrelin systems are altered in neuroendocrine lung carcinoids and associated to clinical-histological features.Lung Cancer. 2017 Jul;109:128-136. doi: 10.1016/j.lungcan.2017.05.006. Epub 2017 May 13.
15 NMDA receptor antagonist prevents cell death in the hippocampal dentate gyrus induced by hyponatremia accompanying adrenal insufficiency in rats.Exp Neurol. 2017 Jan;287(Pt 1):65-74. doi: 10.1016/j.expneurol.2016.08.007. Epub 2016 Aug 12.
16 Fine mapping of the human preprocortistatin gene (CORT) to neuroblastoma consensus deletion region 1p36.3-->p36.2, but absence of mutations in primary tumors.Cytogenet Cell Genet. 2000;89(1-2):62-6. doi: 10.1159/000015566.
17 Mediator Kinase Phosphorylation of STAT1 S727 Promotes Growth of Neoplasms With JAK-STAT Activation.EBioMedicine. 2017 Dec;26:112-125. doi: 10.1016/j.ebiom.2017.11.013. Epub 2017 Nov 21.
18 DNA methylation is associated with inhaled corticosteroid response in persistent childhood asthmatics.Clin Exp Allergy. 2019 Sep;49(9):1225-1234. doi: 10.1111/cea.13447. Epub 2019 Aug 15.
19 A Clinically Relevant Closed-Head Model of Single and Repeat Concussive Injury in the Adult Rat Using a Controlled Cortical Impact Device.J Neurotrauma. 2017 Apr 1;34(7):1351-1363. doi: 10.1089/neu.2016.4517. Epub 2016 Dec 2.
20 The role of Cortistatin-14 in the gastrointestinal motility in mice.Pharmacol Rep. 2018 Apr;70(2):355-363. doi: 10.1016/j.pharep.2017.09.004. Epub 2017 Sep 18.
21 Cortistatin inhibits migration and proliferation of human vascular smooth muscle cells and decreases neointimal formation on carotid artery ligation.Circ Res. 2013 May 24;112(11):1444-55. doi: 10.1161/CIRCRESAHA.112.300695. Epub 2013 Apr 17.
22 Developmental outcomes after gestational antidepressant treatment with sertraline and its discontinuation in an animal model of maternal depression.Behav Brain Res. 2019 Jul 2;366:1-12. doi: 10.1016/j.bbr.2019.03.003. Epub 2019 Mar 2.
23 Circulating levels of cortistatin are correlated with metabolic parameters in patients with newly diagnosed type 2 diabetes mellitus.Peptides. 2017 Aug;94:86-90. doi: 10.1016/j.peptides.2017.05.008. Epub 2017 May 17.
24 Cortistatin binds to TNF- receptors and protects against osteoarthritis.EBioMedicine. 2019 Mar;41:556-570. doi: 10.1016/j.ebiom.2019.02.035. Epub 2019 Feb 28.
25 Levels of the potential biomarker p11 in peripheral blood cells distinguish patients with PTSD from those with other major psychiatric disorders.J Psychiatr Res. 2009 Sep;43(13):1078-85. doi: 10.1016/j.jpsychires.2009.03.010. Epub 2009 Apr 19.
26 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
27 Effect of aflatoxin B(1), benzo[a]pyrene, and methapyrilene on transcriptomic and epigenetic alterations in human liver HepaRG cells. Food Chem Toxicol. 2018 Nov;121:214-223. doi: 10.1016/j.fct.2018.08.034. Epub 2018 Aug 26.
28 Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.