Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTX4K6QZ)

DOT Name T-cell acute lymphocytic leukemia protein 1 (TAL1)
Synonyms TAL-1; Class A basic helix-loop-helix protein 17; bHLHa17; Stem cell protein; T-cell leukemia/lymphoma protein 5
Gene Name TAL1
Related Disease
Adult T-cell leukemia/lymphoma ( )
Generalized anxiety disorder ( )
Lymphoma ( )
Acute erythroid leukemia ( )
Acute leukaemia ( )
Acute lymphocytic leukaemia ( )
Acute myelogenous leukaemia ( )
Acute undifferentiated leukemia ( )
Advanced cancer ( )
Anorexia nervosa cachexia ( )
Arrhythmia ( )
Attention deficit hyperactivity disorder ( )
Breast cancer ( )
Breast carcinoma ( )
Bulimia nervosa ( )
Childhood acute lymphoblastic leukemia ( )
Cutaneous squamous cell carcinoma ( )
Depression ( )
Eating disorder ( )
Glioma ( )
Hepatocellular carcinoma ( )
Huntington disease ( )
leukaemia ( )
Mental disorder ( )
Mixed anxiety and depressive disorder ( )
Neoplasm ( )
Obesity ( )
Obsessive compulsive disorder ( )
Parkinson disease ( )
Post-traumatic stress disorder ( )
Prostate cancer ( )
Prostate carcinoma ( )
Stroke ( )
Chromosomal disorder ( )
Panic disorder ( )
Systemic sclerosis ( )
T-cell leukaemia ( )
T-cell lymphoma ( )
Gastroesophageal reflux disease ( )
Leukemia ( )
Lymphoid leukemia ( )
Non-insulin dependent diabetes ( )
Psychotic disorder ( )
UniProt ID
TAL1_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
2YPA; 2YPB
Pfam ID
PF00010
Sequence
MTERPPSEAARSDPQLEGRDAAEASMAPPHLVLLNGVAKETSRAAAAEPPVIELGARGGP
GGGPAGGGGAARDLKGRDAATAEARHRVPTTELCRPPGPAPAPAPASVTAELPGDGRMVQ
LSPPALAAPAAPGRALLYSLSQPLASLGSGFFGEPDAFPMFTTNNRVKRRPSPYEMEITD
GPHTKVVRRIFTNSRERWRQQNVNGAFAELRKLIPTHPPDKKLSKNEILRLAMKYINFLA
KLLNDQEEEGTQRAKTGKDPVVGAGGGGGGGGGGAPPDDLLQDVLSPNSSCGSSLDGAAS
PDSYTEEPAPKHTARSLHPAMLPAADGAGPR
Function Implicated in the genesis of hemopoietic malignancies. It may play an important role in hemopoietic differentiation. Serves as a positive regulator of erythroid differentiation.
Tissue Specificity Leukemic stem cell.
Reactome Pathway
Transcriptional regulation of granulopoiesis (R-HSA-9616222 )
RUNX1 regulates transcription of genes involved in differentiation of HSCs (R-HSA-8939236 )

Molecular Interaction Atlas (MIA) of This DOT

43 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Adult T-cell leukemia/lymphoma DIS882XU Definitive Biomarker [1]
Generalized anxiety disorder DISPSQCW Definitive Biomarker [2]
Lymphoma DISN6V4S Definitive Altered Expression [3]
Acute erythroid leukemia DISZFC1O Strong Biomarker [4]
Acute leukaemia DISDQFDI Strong Genetic Variation [5]
Acute lymphocytic leukaemia DISPX75S Strong Genetic Variation [6]
Acute myelogenous leukaemia DISCSPTN Strong Altered Expression [7]
Acute undifferentiated leukemia DISJ4SSG Strong Genetic Variation [8]
Advanced cancer DISAT1Z9 Strong Altered Expression [9]
Anorexia nervosa cachexia DISFO5RQ Strong Genetic Variation [10]
Arrhythmia DISFF2NI Strong Altered Expression [11]
Attention deficit hyperactivity disorder DISL8MX9 Strong Genetic Variation [12]
Breast cancer DIS7DPX1 Strong Altered Expression [13]
Breast carcinoma DIS2UE88 Strong Altered Expression [13]
Bulimia nervosa DISGQ59Y Strong Genetic Variation [14]
Childhood acute lymphoblastic leukemia DISJ5D6U Strong Genetic Variation [6]
Cutaneous squamous cell carcinoma DIS3LXUG Strong Biomarker [15]
Depression DIS3XJ69 Strong Genetic Variation [16]
Eating disorder DISVGXN0 Strong Biomarker [17]
Glioma DIS5RPEH Strong Biomarker [18]
Hepatocellular carcinoma DIS0J828 Strong Genetic Variation [19]
Huntington disease DISQPLA4 Strong Genetic Variation [20]
leukaemia DISS7D1V Strong Altered Expression [21]
Mental disorder DIS3J5R8 Strong Biomarker [22]
Mixed anxiety and depressive disorder DISV809X Strong Genetic Variation [23]
Neoplasm DISZKGEW Strong Biomarker [24]
Obesity DIS47Y1K Strong Biomarker [25]
Obsessive compulsive disorder DIS1ZMM2 Strong Biomarker [26]
Parkinson disease DISQVHKL Strong Genetic Variation [27]
Post-traumatic stress disorder DISHL1EY Strong Genetic Variation [28]
Prostate cancer DISF190Y Strong Altered Expression [29]
Prostate carcinoma DISMJPLE Strong Altered Expression [29]
Stroke DISX6UHX Strong Biomarker [30]
Chromosomal disorder DISM5BB5 moderate Genetic Variation [31]
Panic disorder DISD3VNY moderate Genetic Variation [32]
Systemic sclerosis DISF44L6 moderate Genetic Variation [33]
T-cell leukaemia DISJ6YIF moderate Altered Expression [34]
T-cell lymphoma DISSXRTQ moderate Biomarker [35]
Gastroesophageal reflux disease DISQ8G5S Limited Genetic Variation [36]
Leukemia DISNAKFL Limited Biomarker [37]
Lymphoid leukemia DIS65TYQ Limited Altered Expression [35]
Non-insulin dependent diabetes DISK1O5Z Limited Biomarker [38]
Psychotic disorder DIS4UQOT Limited Genetic Variation [39]
------------------------------------------------------------------------------------
⏷ Show the Full List of 43 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
7 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate affects the expression of T-cell acute lymphocytic leukemia protein 1 (TAL1). [40]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate increases the expression of T-cell acute lymphocytic leukemia protein 1 (TAL1). [41]
Arsenic DMTL2Y1 Approved Arsenic affects the expression of T-cell acute lymphocytic leukemia protein 1 (TAL1). [42]
Arsenic trioxide DM61TA4 Approved Arsenic trioxide decreases the expression of T-cell acute lymphocytic leukemia protein 1 (TAL1). [43]
Triclosan DMZUR4N Approved Triclosan decreases the expression of T-cell acute lymphocytic leukemia protein 1 (TAL1). [44]
Amphotericin B DMTAJQE Approved Amphotericin B increases the expression of T-cell acute lymphocytic leukemia protein 1 (TAL1). [45]
KOJIC ACID DMP84CS Investigative KOJIC ACID decreases the expression of T-cell acute lymphocytic leukemia protein 1 (TAL1). [47]
------------------------------------------------------------------------------------
⏷ Show the Full List of 7 Drug(s)
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene affects the methylation of T-cell acute lymphocytic leukemia protein 1 (TAL1). [46]
------------------------------------------------------------------------------------

References

1 Aberrant TAL1 activation is mediated by an interchromosomal interaction in human T-cell acute lymphoblastic leukemia.Leukemia. 2014 Feb;28(2):349-61. doi: 10.1038/leu.2013.158. Epub 2013 May 23.
2 Parental Stress of Preschool Children With Generalized Anxiety or Oppositional Defiant Disorder.Front Pediatr. 2019 Oct 17;7:415. doi: 10.3389/fped.2019.00415. eCollection 2019.
3 Defects of the mismatch repair gene MSH2 are implicated in the development of murine and human lymphoblastic lymphomas and are associated with the aberrant expression of rhombotin-2 (Lmo-2) and Tal-1 (SCL).Blood. 1997 Apr 1;89(7):2276-82.
4 A novel role for Lyl1 in primitive erythropoiesis.Development. 2018 Oct 11;145(19):dev162990. doi: 10.1242/dev.162990.
5 Primers and protocols for standardized detection of minimal residual disease in acute lymphoblastic leukemia using immunoglobulin and T cell receptor gene rearrangements and TAL1 deletions as PCR targets: report of the BIOMED-1 CONCERTED ACTION: investigation of minimal residual disease in acute leukemia.Leukemia. 1999 Jan;13(1):110-8. doi: 10.1038/sj.leu.2401245.
6 Genome-Wide Association Study of Susceptibility Loci for T-Cell Acute Lymphoblastic Leukemia in Children.J Natl Cancer Inst. 2019 Dec 1;111(12):1350-1357. doi: 10.1093/jnci/djz043.
7 Pattern of expression and their clinical implications of the GATA family, stem cell leukemia gene, and EVI1 in leukemia and myelodysplastic syndromes.Leuk Lymphoma. 1996 Nov;23(5-6):431-6. doi: 10.3109/10428199609054850.
8 Shared roles for Scl and Lyl1 in murine platelet production and function.Blood. 2019 Sep 5;134(10):826-835. doi: 10.1182/blood.2019896175. Epub 2019 Jul 12.
9 The Cancer Stem Cell Inhibitor Napabucasin (BBI608) Shows General Cytotoxicity in Biliary Tract Cancer Cells and Reduces Cancer Stem Cell Characteristics.Cancers (Basel). 2019 Feb 26;11(3):276. doi: 10.3390/cancers11030276.
10 Network analysis of specific psychopathology and psychiatric symptoms in patients with anorexia nervosa.Eur Eat Disord Rev. 2019 Jan;27(1):24-33. doi: 10.1002/erv.2633. Epub 2018 Jul 31.
11 Associations between maternal physiology and maternal sensitivity vary depending on infant distress and emotion context.J Fam Psychol. 2019 Jun;33(4):412-421. doi: 10.1037/fam0000538. Epub 2019 Apr 25.
12 Relationship of Probable Attention Deficit Hyperactivity Disorder with Severity of Psychopathology and Impulsivity in a Sample of Male Patients with Opioid Use Disorder.Psychiatry Investig. 2018 Feb;15(2):164-171. doi: 10.30773/pi.2017.05.14.1. Epub 2017 Dec 1.
13 The expression of stem cell protein Piwil2 and piR-932 in breast cancer.Surg Oncol. 2013 Dec;22(4):217-23. doi: 10.1016/j.suronc.2013.07.001. Epub 2013 Aug 27.
14 Exercise Obsession and Compulsion in Adults With Longstanding Eating Disorders: Validation of the Norwegian Version of the Compulsive Exercise Test.Front Psychol. 2019 Oct 22;10:2370. doi: 10.3389/fpsyg.2019.02370. eCollection 2019.
15 Fibulin-3 Has Anti-Tumorigenic Activities inCutaneous Squamous Cell Carcinoma.J Invest Dermatol. 2019 Aug;139(8):1798-1808.e5. doi: 10.1016/j.jid.2019.01.022. Epub 2019 Feb 6.
16 Explanatory variables for women's increased risk for mental health problems in Vietnam.Soc Psychiatry Psychiatr Epidemiol. 2020 Mar;55(3):359-369. doi: 10.1007/s00127-019-01761-3. Epub 2019 Aug 28.
17 Kindness begins with yourself: The role of self-compassion in adolescent body satisfaction and eating pathology.Int J Eat Disord. 2019 Jul;52(7):809-816. doi: 10.1002/eat.23081. Epub 2019 Apr 12.
18 FXR1 promotes the malignant biological behavior of glioma cells via stabilizing MIR17HG.J Exp Clin Cancer Res. 2019 Jan 28;38(1):37. doi: 10.1186/s13046-018-0991-0.
19 Identification of metabolism-associated pathways and genes involved in male and female liver cancer patients.J Theor Biol. 2019 Nov 7;480:218-228. doi: 10.1016/j.jtbi.2019.08.011. Epub 2019 Aug 13.
20 Importance of psychiatric examination in predictive genetic testing for Huntington disease.Neurol Neurochir Pol. 2013 Nov-Dec;47(6):534-41. doi: 10.5114/ninp.2013.39070.
21 Splicing factor SF3B1K700E mutant dysregulates erythroid differentiation via aberrant alternative splicing of transcription factor TAL1.PLoS One. 2017 May 18;12(5):e0175523. doi: 10.1371/journal.pone.0175523. eCollection 2017.
22 Clinical and psychological outcome after surgery for lumbar spinal stenosis: A prospective observational study with analysis of prognostic factors.Neurol Neurochir Pol. 2018 Jan-Feb;52(1):70-74. doi: 10.1016/j.pjnns.2017.12.002. Epub 2017 Dec 8.
23 An overview of which health domains to consider and when to apply them in measurement-based care for depression and anxiety disorders.Nord J Psychiatry. 2018 Jul;72(5):367-373. doi: 10.1080/08039488.2018.1465592. Epub 2018 May 1.
24 Detection of novel fusion-transcripts by RNA-Seq in T-cell lymphoblastic lymphoma.Sci Rep. 2019 Mar 26;9(1):5179. doi: 10.1038/s41598-019-41675-3.
25 Validation of the Italian version of the Laval questionnaire: health-related quality of life in subjects with obesity.Health Qual Life Outcomes. 2017 May 15;15(1):101. doi: 10.1186/s12955-017-0671-3.
26 Psychological Characteristics of Inflammatory Bowel Disease Patients: A Comparison Between Active and Nonactive Patients.Inflamm Bowel Dis. 2019 Jul 17;25(8):1399-1407. doi: 10.1093/ibd/izy400.
27 The prevalence of psychological distress in Parkinson's disease patients: The brief symptom inventory (BSI-18) versus the Hopkins symptom checklist (SCL-90-R).Prog Neuropsychopharmacol Biol Psychiatry. 2019 Jan 10;88:96-101. doi: 10.1016/j.pnpbp.2018.07.012. Epub 2018 Jul 12.
28 Interpreter-mediated psychotherapy with trauma-affected refugees - A retrospective cohort study.Psychiatry Res. 2019 Jan;271:684-692. doi: 10.1016/j.psychres.2018.12.058. Epub 2018 Dec 10.
29 Transcriptional regulatory networks in human lung adenocarcinoma.Mol Med Rep. 2012 Nov;6(5):961-6. doi: 10.3892/mmr.2012.1034. Epub 2012 Aug 14.
30 Mobility Function and Recovery After Stroke: Preliminary Insights From Sympathetic Nervous System Activity.J Neurol Phys Ther. 2018 Oct;42(4):224-232. doi: 10.1097/NPT.0000000000000238.
31 Simultaneous translocation of both TCR Loci (14q11) with rare partner loci (Xq22 and 12p13) in a case of T-lymphoblastic leukemia.Ann Lab Med. 2012 May;32(3):220-4. doi: 10.3343/alm.2012.32.3.220. Epub 2012 Apr 18.
32 GLRB allelic variation associated with agoraphobic cognitions, increased startle response and fear network activation: a potential neurogenetic pathway to panic disorder.Mol Psychiatry. 2017 Oct;22(10):1431-1439. doi: 10.1038/mp.2017.2. Epub 2017 Feb 7.
33 Extensive surface phenotyping of alveolar macrophages in interstitial lung disease.Clin Immunol. 2000 Jan;94(1):33-41. doi: 10.1006/clim.1999.4803.
34 Stem Cell Leukemia: how a TALented actor can go awry on the hematopoietic stage.Leukemia. 2016 Oct;30(10):1968-1978. doi: 10.1038/leu.2016.169. Epub 2016 Jun 13.
35 Enhanced Notch activation is advantageous but not essential for T cell lymphomagenesis in Id1 transgenic mice.PLoS One. 2012;7(2):e32944. doi: 10.1371/journal.pone.0032944. Epub 2012 Feb 29.
36 Independent factors associated with the impact of gastroesophageal reflux disease on health-related quality of life.Rev Esp Enferm Dig. 2019 Feb;111(2):94-100. doi: 10.17235/reed.2018.5752/2018.
37 The subclonal complexity of STIL-TAL1+ T-cell acute lymphoblastic leukaemia.Leukemia. 2018 Sep;32(9):1984-1993. doi: 10.1038/s41375-018-0046-8. Epub 2018 Mar 20.
38 Assessment of erectile dysfunction and associated psychological distress in Chinese men with type 2 diabetes mellitus.Int J Impot Res. 2017 Sep;29(5):210-214. doi: 10.1038/ijir.2017.25. Epub 2017 Jun 29.
39 Psychiatric symptoms in migraine patients and their attitudes towards psychological support on stigmatization.J Clin Neurosci. 2019 Apr;62:180-183. doi: 10.1016/j.jocn.2018.11.035. Epub 2018 Nov 22.
40 Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
41 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
42 Drinking-water arsenic exposure modulates gene expression in human lymphocytes from a U.S. population. Environ Health Perspect. 2008 Apr;116(4):524-31. doi: 10.1289/ehp.10861.
43 In vitro dual effect of arsenic trioxide on hemopoiesis: inhibition of erythropoiesis and stimulation of megakaryocytic maturation. Blood Cells Mol Dis. 2006 Jan-Feb;36(1):59-76. doi: 10.1016/j.bcmd.2005.10.005. Epub 2005 Dec 15.
44 Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
45 Differential expression of microRNAs and their predicted targets in renal cells exposed to amphotericin B and its complex with copper (II) ions. Toxicol Mech Methods. 2017 Sep;27(7):537-543. doi: 10.1080/15376516.2017.1333554. Epub 2017 Jun 8.
46 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
47 Toxicogenomics of kojic acid on gene expression profiling of a375 human malignant melanoma cells. Biol Pharm Bull. 2006 Apr;29(4):655-69.