Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTXY1WVH)

• DOT Name: RNA binding protein fox-1 homolog 2 (RBFOX2)
• Synonyms: Fox-1 homolog B; Hexaribonucleotide-binding protein 2; RNA-binding motif protein 9; RNA-binding protein 9; Repressor of tamoxifen transcriptional activity
• Gene Name: RBFOX2
• Related Disease:
  Nephrocalcinosis
  Autoimmune haemolytic anaemia
  Burkitt lymphoma
  Cardiac failure
  Cardiomyopathy
  Childhood epilepsy with centrotemporal spikes
  Cleft palate
  Colon cancer
  Colon carcinoma
  Congestive heart failure
  Epilepsy
  Epithelial ovarian cancer
  Estrogen-receptor positive breast cancer
  Hyperinsulinemia
  Hypoplastic left heart syndrome 1
  Isolated cleft palate
  Kaposi sarcoma
  Lung cancer
  Lung carcinoma
  Neoplasm
  Osteopetrosis
  Ovarian cancer
  Ovarian neoplasm
  Proximal renal tubular acidosis
  Renal tubular acidosis
  Scleroderma
  Specific language impairment
  Systemic sclerosis
  Tendinopathy
  Tuberculosis
  Alcohol dependence
  Carcinoma of liver and intrahepatic biliary tract
  Chronic kidney disease
  High blood pressure
  Liver cancer
  Movement disorder
  Acute myelogenous leukaemia
  Asthma
  Breast cancer
  Breast carcinoma
  leukaemia
  Leukemia
  Advanced cancer
  Intellectual disability
  Nasopharyngeal carcinoma
  Type-1/2 diabetes
• UniProt ID: RFOX2_HUMAN
• PDB ID: 2CQ3
• Pfam ID: PF12414 ; PF00076
• Sequence:
  MQNEPLTPGYHGFPARDSQGNQEPTTTPDAMVQPFTTIPFPPPPQNGIPTEYGVPHTQDY
  AGQTGEHNLTLYGSTQAHGEQSSNSPSTQNGSLTTEGGAQTDGQQSQTQSSENSESKSTP
  KRLHVSNIPFRFRDPDLRQMFGQFGKILDVEIIFNERGSKGFGFVTFENSADADRAREKL
  HGTVVEGRKIEVNNATARVMTNKKMVTPYANGWKLSPVVGAVYGPELYAASSFQADVSLG
  NDAAVPLSGRGGINTYIPLISLPLVPGFPYPTAATTAAAFRGAHLRGRGRTVYGAVRAVP
  PTAIPAYPGVVYQDGFYGADLYGGYAAYRYAQPATATAATAAAAAAAAYSDGYGRVYTAD
  PYHALAPAASYGVGAVASLYRGGYSRFAPY
• Function: RNA-binding protein that regulates alternative splicing events by binding to 5'-UGCAUGU-3' elements. Prevents binding of U2AF2 to the 3'-splice site. Regulates alternative splicing of tissue-specific exons and of differentially spliced exons during erythropoiesis. RNA-binding protein that seems to act as a coregulatory factor of ER-alpha. Together with RNA binding proteins RBPMS and MBNL1/2, activates vascular smooth muscle cells alternative splicing events.
• Reactome Pathway: FGFR2 alternative splicing (R-HSA-6803529)

Molecular Interaction Atlas (MIA) of This DOT

46 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Nephrocalcinosis	DIS5ZVJP	Definitive	Biomarker	[1]
Autoimmune haemolytic anaemia	DIS7MS3M	Strong	Biomarker	[2]
Burkitt lymphoma	DIS9D5XU	Strong	Biomarker	[3]
Cardiac failure	DISDC067	Strong	Biomarker	[4]
Cardiomyopathy	DISUPZRG	Strong	Biomarker	[5]
Childhood epilepsy with centrotemporal spikes	DISKT2L5	Strong	Genetic Variation	[6]
Cleft palate	DIS6G5TF	Strong	Altered Expression	[7]
Colon cancer	DISVC52G	Strong	Biomarker	[8]
Colon carcinoma	DISJYKUO	Strong	Biomarker	[8]
Congestive heart failure	DIS32MEA	Strong	Biomarker	[4]
Epilepsy	DISBB28L	Strong	Genetic Variation	[6]
Epithelial ovarian cancer	DIS56MH2	Strong	Biomarker	[9]
Estrogen-receptor positive breast cancer	DIS1H502	Strong	Genetic Variation	[10]
Hyperinsulinemia	DISIDWT6	Strong	Biomarker	[11]
Hypoplastic left heart syndrome 1	DISW3OY8	Strong	Biomarker	[12]
Isolated cleft palate	DISV80CD	Strong	Altered Expression	[7]
Kaposi sarcoma	DISC1H1Z	Strong	Genetic Variation	[13]
Lung cancer	DISCM4YA	Strong	Altered Expression	[14]
Lung carcinoma	DISTR26C	Strong	Altered Expression	[14]
Neoplasm	DISZKGEW	Strong	Altered Expression	[9]
Osteopetrosis	DIS7GHNM	Strong	Biomarker	[15]
Ovarian cancer	DISZJHAP	Strong	Biomarker	[9]
Ovarian neoplasm	DISEAFTY	Strong	Biomarker	[9]
Proximal renal tubular acidosis	DIS8M3CV	Strong	Biomarker	[16]
Renal tubular acidosis	DISE1NDR	Strong	Altered Expression	[17]
Scleroderma	DISVQ342	Strong	Altered Expression	[18]
Specific language impairment	DISEKRML	Strong	Genetic Variation	[19]
Systemic sclerosis	DISF44L6	Strong	Altered Expression	[18]
Tendinopathy	DISJH7UX	Strong	Biomarker	[20]
Tuberculosis	DIS2YIMD	Strong	Biomarker	[21]
Alcohol dependence	DIS4ZSCO	moderate	Biomarker	[22]
Carcinoma of liver and intrahepatic biliary tract	DIS8WA0W	moderate	Biomarker	[23]
Chronic kidney disease	DISW82R7	moderate	Biomarker	[1]
High blood pressure	DISY2OHH	moderate	Biomarker	[24]
Liver cancer	DISDE4BI	moderate	Biomarker	[23]
Movement disorder	DISOJJ2D	moderate	CausalMutation	[12]
Acute myelogenous leukaemia	DISCSPTN	Disputed	Biomarker	[25]
Asthma	DISW9QNS	Disputed	Biomarker	[26]
Breast cancer	DIS7DPX1	Disputed	Genetic Variation	[10]
Breast carcinoma	DIS2UE88	Disputed	Genetic Variation	[10]
leukaemia	DISS7D1V	Disputed	Biomarker	[25]
Leukemia	DISNAKFL	Disputed	Biomarker	[25]
Advanced cancer	DISAT1Z9	Limited	Biomarker	[27]
Intellectual disability	DISMBNXP	Limited	Biomarker	[28]
Nasopharyngeal carcinoma	DISAOTQ0	Limited	Altered Expression	[29]
Type-1/2 diabetes	DISIUHAP	Limited	Altered Expression	[30]

This DOT Affected the Drug Response of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Cisplatin	DMRHGI9	Approved	RNA binding protein fox-1 homolog 2 (RBFOX2) affects the response to substance of Cisplatin.	[43]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the methylation of RNA binding protein fox-1 homolog 2 (RBFOX2).	[31]
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 increases the phosphorylation of RNA binding protein fox-1 homolog 2 (RBFOX2).	[38]

10 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of RNA binding protein fox-1 homolog 2 (RBFOX2).	[32]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of RNA binding protein fox-1 homolog 2 (RBFOX2).	[33]
Vorinostat	DMWMPD4	Approved	Vorinostat decreases the expression of RNA binding protein fox-1 homolog 2 (RBFOX2).	[34]
Tocopherol	DMBIJZ6	Phase 2	Tocopherol decreases the expression of RNA binding protein fox-1 homolog 2 (RBFOX2).	[35]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of RNA binding protein fox-1 homolog 2 (RBFOX2).	[36]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of RNA binding protein fox-1 homolog 2 (RBFOX2).	[37]
Torcetrapib	DMDHYM7	Discontinued in Phase 2	Torcetrapib increases the expression of RNA binding protein fox-1 homolog 2 (RBFOX2).	[39]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the expression of RNA binding protein fox-1 homolog 2 (RBFOX2).	[40]
GALLICACID	DM6Y3A0	Investigative	GALLICACID increases the expression of RNA binding protein fox-1 homolog 2 (RBFOX2).	[41]
Nickel chloride	DMI12Y8	Investigative	Nickel chloride decreases the expression of RNA binding protein fox-1 homolog 2 (RBFOX2).	[42]

References

• [1] A novel SLC4A1 variant in an autosomal dominant distal renal tubular acidosis family with a severe phenotype.Endocrine. 2010 Jun;37(3):473-8. doi: 10.1007/s12020-010-9340-6. Epub 2010 Apr 17.
• [2] AN UNUSUAL CASE OF FAMILIAL SYSTEMIC LUPUS ERYTHEMATOSUS WITH DISTAL RENAL TUBULAR ACIDOSIS AND HEMOLYTIC ANEMIA.Iran J Kidney Dis. 2019 Sep;13(5):337-339.
• [3] IRF4 promotes Epstein-Barr virus activation in Burkitt's lymphoma cells.J Gen Virol. 2019 May;100(5):851-862. doi: 10.1099/jgv.0.001249. Epub 2019 Mar 25.
• [4] RBFox2-miR-34a-Jph2 axis contributes to cardiac decompensation during heart failure.Proc Natl Acad Sci U S A. 2019 Mar 26;116(13):6172-6180. doi: 10.1073/pnas.1822176116. Epub 2019 Mar 13.
• [5] Genes of the cGMP-PKG-Ca(2+) signaling pathway are alternatively spliced in cardiomyopathy: Role of RBFOX2.Biochim Biophys Acta Mol Basis Dis. 2020 Mar 1;1866(3):165620. doi: 10.1016/j.bbadis.2019.165620. Epub 2019 Nov 25.
• [6] RBFOX1 and RBFOX3 mutations in rolandic epilepsy.PLoS One. 2013 Sep 6;8(9):e73323. doi: 10.1371/journal.pone.0073323. eCollection 2013.
• [7] Neural crest-specific deletion of Rbfox2 in mice leads to craniofacial abnormalities including cleft palate.Elife. 2019 Jun 26;8:e45418. doi: 10.7554/eLife.45418.
• [8] Constructing disease-specific gene networks using pair-wise relevance metric: application to colon cancer identifies interleukin 8, desmin and enolase 1 as the central elements.BMC Syst Biol. 2008 Aug 10;2:72. doi: 10.1186/1752-0509-2-72.
• [9] The long non-coding RNA MALAT1 promotes ovarian cancer progression by regulating RBFOX2-mediated alternative splicing.Mol Carcinog. 2019 Feb;58(2):196-205. doi: 10.1002/mc.22919. Epub 2018 Oct 28.
• [10] Associations of polymorphisms in the genes of FGFR2, FGF1, and RBFOX2 with breast cancer risk by estrogen/progesterone receptor status.Mol Carcinog. 2013 Nov;52 Suppl 1:E52-9. doi: 10.1002/mc.21979. Epub 2012 Nov 9.
• [11] Neuron-enriched RNA-binding Proteins Regulate Pancreatic Beta Cell Function and Survival.J Biol Chem. 2017 Feb 24;292(8):3466-3480. doi: 10.1074/jbc.M116.748335. Epub 2017 Jan 11.
• [12] Rbfox2 function in RNA metabolism is impaired in hypoplastic left heart syndrome patient hearts.Sci Rep. 2016 Aug 3;6:30896. doi: 10.1038/srep30896.
• [13] Two microPeptides are translated from a KSHV polycistronic RNA in human cells by leaky scanning mechanism.Biochem Biophys Res Commun. 2020 Feb 12;522(3):568-573. doi: 10.1016/j.bbrc.2019.11.087. Epub 2019 Nov 27.
• [14] Exon array analysis using re-defined probe sets results in reliable identification of alternatively spliced genes in non-small cell lung cancer.BMC Genomics. 2010 Nov 30;11:676. doi: 10.1186/1471-2164-11-676.
• [15] Familial pure proximal renal tubular acidosis--a clinical and genetic study.Nephrol Dial Transplant. 2008 Apr;23(4):1211-5. doi: 10.1093/ndt/gfm583. Epub 2007 Sep 19.
• [16] Hereditary renal tubular disorders in Turkey: demographic, clinical, and laboratory features.Clin Exp Nephrol. 2011 Feb;15(1):108-13. doi: 10.1007/s10157-010-0367-z. Epub 2010 Nov 20.
• [17] Modulation of Kaposi's sarcoma-associated herpesvirus infection and replication by MEK/ERK, JNK, and p38 multiple mitogen-activated protein kinase pathways during primary infection.J Virol. 2006 Jun;80(11):5371-82. doi: 10.1128/JVI.02299-05.
• [18] Fox-2 protein regulates the alternative splicing of scleroderma-associated lysyl hydroxylase 2 messenger RNA.Arthritis Rheum. 2010 Apr;62(4):1167-75. doi: 10.1002/art.27315.
• [19] Genome-wide screening for DNA variants associated with reading and language traits.Genes Brain Behav. 2014 Sep;13(7):686-701. doi: 10.1111/gbb.12158. Epub 2014 Aug 29.
• [20] Alternative splicing induces cytoplasmic localization of RBFOX2 protein in calcific tendinopathy.Exp Mol Pathol. 2019 Aug;109:36-41. doi: 10.1016/j.yexmp.2019.104264. Epub 2019 May 23.
• [21] Paediatric deaths in a tertiary government hospital setting, Malawi.Paediatr Int Child Health. 2019 Nov;39(4):240-248. doi: 10.1080/20469047.2018.1536873. Epub 2018 Nov 19.
• [22] Patients with alcohol use disorder: initial results from a prospective multicenter registry in the Spanish Network on Addiction Disorders. CohRTA Study.Adicciones. 2018 Jan 12;30(4):292-300. doi: 10.20882/adicciones.931.
• [23] Growth inhibition of hepatocellular carcinoma cells in vitro and in vivo by the 8-methoxy analog of WMC79.Cancer Chemother Pharmacol. 2009 Apr;63(5):769-78. doi: 10.1007/s00280-008-0801-z. Epub 2008 Jul 19.
• [24] Aberrant Splicing Induced by Dysregulated Rbfox2 Produces Enhanced Function of Ca(V)1.2 Calcium Channel and Vascular Myogenic Tone in Hypertension.Hypertension. 2017 Dec;70(6):1183-1192. doi: 10.1161/HYPERTENSIONAHA.117.09301. Epub 2017 Oct 9.
• [25] Role of peroxisome proliferator-activated receptor-gamma and its coactivator DRIP205 in cellular responses to CDDO (RTA-401) in acute myelogenous leukemia.Cancer Res. 2010 Jun 15;70(12):4949-60. doi: 10.1158/0008-5472.CAN-09-1962. Epub 2010 May 25.
• [26] Nrf2 Activator RTA-408 Protects Against Ozone-Induced Acute Asthma Exacerbation by Suppressing ROS and T17 Cells.Inflammation. 2019 Oct;42(5):1843-1856. doi: 10.1007/s10753-019-01046-6.
• [27] Rbfox2 dissociation from stress granules suppresses cancer progression.Exp Mol Med. 2019 Apr 26;51(4):1-12. doi: 10.1038/s12276-019-0246-y.
• [28] Genetic diseases of acid-base transporters.Annu Rev Physiol. 2002;64:899-923. doi: 10.1146/annurev.physiol.64.092801.141759.
• [29] Rta-IgG as a biomarker for diagnosis and post treatment prognostic of nasopharyngeal carcinoma.Cancer Biomark. 2016;16(3):467-76. doi: 10.3233/CBM-160586.
• [30] Dysregulation of RBFOX2 Is an Early Event in Cardiac Pathogenesis of Diabetes.Cell Rep. 2016 Jun 7;15(10):2200-2213. doi: 10.1016/j.celrep.2016.05.002. Epub 2016 May 26.
• [31] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [32] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [33] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [34] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [35] Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
• [36] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [37] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [38] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [39] Clarifying off-target effects for torcetrapib using network pharmacology and reverse docking approach. BMC Syst Biol. 2012 Dec 10;6:152.
• [40] Characterization of the Molecular Alterations Induced by the Prolonged Exposure of Normal Colon Mucosa and Colon Cancer Cells to Low-Dose Bisphenol A. Int J Mol Sci. 2022 Oct 1;23(19):11620. doi: 10.3390/ijms231911620.
• [41] Gene expression profile analysis of gallic acid-induced cell death process. Sci Rep. 2021 Aug 18;11(1):16743. doi: 10.1038/s41598-021-96174-1.
• [42] The contact allergen nickel triggers a unique inflammatory and proangiogenic gene expression pattern via activation of NF-kappaB and hypoxia-inducible factor-1alpha. J Immunol. 2007 Mar 1;178(5):3198-207.
• [43] Gene expression profiling of 30 cancer cell lines predicts resistance towards 11 anticancer drugs at clinically achieved concentrations. Int J Cancer. 2006 Apr 1;118(7):1699-712. doi: 10.1002/ijc.21570.