Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTXY7J96)

DOT Name Craniofacial development protein 1 (CFDP1)
Synonyms Bucentaur
Gene Name CFDP1
Related Disease
Malaria ( )
Adult lymphoma ( )
Adult T-cell leukemia/lymphoma ( )
Alzheimer disease ( )
Alzheimer disease 3 ( )
B-cell acute lymphoblastic leukaemia ( )
Carcinoma ( )
Cardiovascular disease ( )
Cervical Intraepithelial neoplasia ( )
Chronic obstructive pulmonary disease ( )
Coronary heart disease ( )
Frontotemporal dementia ( )
Inclusion body myopathy with Paget disease of bone and frontotemporal dementia ( )
Inclusion body myopathy with Paget disease of bone and frontotemporal dementia type 1 ( )
Lung adenocarcinoma ( )
Lymphoma ( )
Mantle cell lymphoma ( )
Pediatric lymphoma ( )
Pick disease ( )
Plasma cell myeloma ( )
Premature aging syndrome ( )
Rheumatoid arthritis ( )
Squamous cell carcinoma ( )
Amyotrophic lateral sclerosis ( )
Cervical carcinoma ( )
Dementia ( )
Herpes simplex infection ( )
Influenza ( )
Moyamoya disease ( )
Ankylosing spondylitis ( )
Atherosclerosis ( )
Bone Paget disease ( )
Cervical cancer ( )
Coronary atherosclerosis ( )
Cutaneous squamous cell carcinoma ( )
Enterovirus infection ( )
Melanoma ( )
Migraine disorder ( )
Myopathy ( )
Nervous system disease ( )
Spinocerebellar ataxia type 3 ( )
UniProt ID
CFDP1_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF07572
Sequence
MEEFDSEDFSTSEEDEDYVPSGGEYSEDDVNELVKEDEVDGEEQTQKTQGKKRKAQSIPA
RKRRQGGLSLEEEEEEDANSESEGSSSEEEDDAAEQEKGIGSEDARKKKEDELWASFLND
VGPKSKVPPSTQVKKGEETEETSSSKLLVKAEELEKPKETEKVKITKVFDFAGEEVRVTK
EVDATSKEAKSFFKQNEKEKPQANVPSALPSLPAGSGLKRSSGMSSLLGKIGAKKQKMST
LEKSKLDWESFKEEEGIGEELAIHNRGKEGYIERKAFLDRVDHRQFEIERDLRLSKMKP
Function May play a role during embryogenesis.
Tissue Specificity Ubiquitous.

Molecular Interaction Atlas (MIA) of This DOT

41 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Malaria DISQ9Y50 Definitive Biomarker [1]
Adult lymphoma DISK8IZR Strong Altered Expression [2]
Adult T-cell leukemia/lymphoma DIS882XU Strong Biomarker [3]
Alzheimer disease DISF8S70 Strong Altered Expression [4]
Alzheimer disease 3 DISVT69G Strong Altered Expression [4]
B-cell acute lymphoblastic leukaemia DISKLOKC Strong Biomarker [5]
Carcinoma DISH9F1N Strong Biomarker [6]
Cardiovascular disease DIS2IQDX Strong Genetic Variation [7]
Cervical Intraepithelial neoplasia DISXP757 Strong Posttranslational Modification [8]
Chronic obstructive pulmonary disease DISQCIRF Strong Genetic Variation [9]
Coronary heart disease DIS5OIP1 Strong Genetic Variation [10]
Frontotemporal dementia DISKYHXL Strong Genetic Variation [11]
Inclusion body myopathy with Paget disease of bone and frontotemporal dementia DISK4S94 Strong Genetic Variation [12]
Inclusion body myopathy with Paget disease of bone and frontotemporal dementia type 1 DISHQXXA Strong Genetic Variation [13]
Lung adenocarcinoma DISD51WR Strong Biomarker [14]
Lymphoma DISN6V4S Strong Altered Expression [2]
Mantle cell lymphoma DISFREOV Strong Biomarker [15]
Pediatric lymphoma DIS51BK2 Strong Altered Expression [2]
Pick disease DISP6X50 Strong Genetic Variation [11]
Plasma cell myeloma DIS0DFZ0 Strong Biomarker [16]
Premature aging syndrome DIS51AGT Strong Biomarker [17]
Rheumatoid arthritis DISTSB4J Strong Altered Expression [18]
Squamous cell carcinoma DISQVIFL Strong Posttranslational Modification [8]
Amyotrophic lateral sclerosis DISF7HVM moderate Genetic Variation [19]
Cervical carcinoma DIST4S00 moderate Biomarker [14]
Dementia DISXL1WY moderate Biomarker [20]
Herpes simplex infection DISL1SAV moderate Altered Expression [21]
Influenza DIS3PNU3 moderate Altered Expression [21]
Moyamoya disease DISO62CA moderate Genetic Variation [22]
Ankylosing spondylitis DISRC6IR Limited Genetic Variation [23]
Atherosclerosis DISMN9J3 Limited Genetic Variation [24]
Bone Paget disease DISIPS4V Limited Genetic Variation [25]
Cervical cancer DISFSHPF Limited Biomarker [26]
Coronary atherosclerosis DISKNDYU Limited Genetic Variation [27]
Cutaneous squamous cell carcinoma DIS3LXUG Limited Altered Expression [28]
Enterovirus infection DISH2UDP Limited Biomarker [29]
Melanoma DIS1RRCY Limited Biomarker [30]
Migraine disorder DISFCQTG Limited Genetic Variation [31]
Myopathy DISOWG27 Limited Genetic Variation [11]
Nervous system disease DISJ7GGT Limited Genetic Variation [32]
Spinocerebellar ataxia type 3 DISQBQID Limited Biomarker [33]
------------------------------------------------------------------------------------
⏷ Show the Full List of 41 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
10 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the expression of Craniofacial development protein 1 (CFDP1). [34]
Acetaminophen DMUIE76 Approved Acetaminophen increases the expression of Craniofacial development protein 1 (CFDP1). [35]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate decreases the expression of Craniofacial development protein 1 (CFDP1). [36]
Cisplatin DMRHGI9 Approved Cisplatin affects the expression of Craniofacial development protein 1 (CFDP1). [37]
Ivermectin DMDBX5F Approved Ivermectin decreases the expression of Craniofacial development protein 1 (CFDP1). [38]
Decitabine DMQL8XJ Approved Decitabine affects the expression of Craniofacial development protein 1 (CFDP1). [37]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the expression of Craniofacial development protein 1 (CFDP1). [39]
PMID28460551-Compound-2 DM4DOUB Patented PMID28460551-Compound-2 decreases the expression of Craniofacial development protein 1 (CFDP1). [40]
Trichostatin A DM9C8NX Investigative Trichostatin A increases the expression of Craniofacial development protein 1 (CFDP1). [41]
Milchsaure DM462BT Investigative Milchsaure decreases the expression of Craniofacial development protein 1 (CFDP1). [42]
------------------------------------------------------------------------------------
⏷ Show the Full List of 10 Drug(s)

References

1 Distinct effects of HIV protease inhibitors and ERAD inhibitors on zygote to ookinete transition of the malaria parasite.Mol Biochem Parasitol. 2018 Mar;220:10-14. doi: 10.1016/j.molbiopara.2017.12.003. Epub 2018 Jan 3.
2 The Transitional Endoplasmic Reticulum ATPase p97 Regulates the Alternative Nuclear Factor NF-B Signaling via Partial Degradation of the NF-B Subunit p100.J Biol Chem. 2015 Aug 7;290(32):19558-68. doi: 10.1074/jbc.M114.630061. Epub 2015 Jun 25.
3 p53 stabilization and functional impairment in the absence of genetic mutation or the alteration of the p14(ARF)-MDM2 loop in ex vivo and cultured adult T-cell leukemia/lymphoma cells.Blood. 2000 Jun 15;95(12):3939-44.
4 Melanotransferrin is produced by senile plaque-associated reactive microglia in Alzheimer's disease.Brain Res. 1999 Oct 16;845(1):1-5. doi: 10.1016/s0006-8993(99)01767-9.
5 Valosin-Containing Protein/p97 as a Novel Therapeutic Target in Acute Lymphoblastic Leukemia.Neoplasia. 2017 Oct;19(10):750-761. doi: 10.1016/j.neo.2017.08.001. Epub 2017 Aug 29.
6 Comparison of recombinant and synthetically formed monoclonal antibody-beta-lactamase conjugates for anticancer prodrug activation.Bioconjug Chem. 1999 Nov-Dec;10(6):1084-9. doi: 10.1021/bc990075w.
7 Leveraging Polygenic Functional Enrichment to Improve GWAS Power.Am J Hum Genet. 2019 Jan 3;104(1):65-75. doi: 10.1016/j.ajhg.2018.11.008. Epub 2018 Dec 27.
8 Human papillomavirus types 16 E1 mRNA is transcribed from P14 early promoter in cervical neoplasms.Virology. 2016 Jan 15;488:196-201. doi: 10.1016/j.virol.2015.11.015. Epub 2015 Dec 2.
9 Genetic landscape of chronic obstructive pulmonary disease identifies heterogeneous cell-type and phenotype associations.Nat Genet. 2019 Mar;51(3):494-505. doi: 10.1038/s41588-018-0342-2. Epub 2019 Feb 25.
10 Genetic overlap of chronic obstructive pulmonary disease and cardiovascular disease-related traits: a large-scale genome-wide cross-trait analysis.Respir Res. 2019 Apr 2;20(1):64. doi: 10.1186/s12931-019-1036-8.
11 A conserved inter-domain communication mechanism regulates the ATPase activity of the AAA-protein Drg1.Sci Rep. 2017 Mar 17;7:44751. doi: 10.1038/srep44751.
12 ZFAND1 Recruits p97 and the 26S Proteasome to Promote the Clearance of Arsenite-Induced Stress Granules.Mol Cell. 2018 Jun 7;70(5):906-919.e7. doi: 10.1016/j.molcel.2018.04.021. Epub 2018 May 24.
13 Interaction between the AAA(+) ATPase p97 and its cofactor ataxin3 in health and disease: Nucleotide-induced conformational changes regulate cofactor binding.J Biol Chem. 2017 Nov 10;292(45):18392-18407. doi: 10.1074/jbc.M117.806281. Epub 2017 Sep 22.
14 Tobacco smoke activates human papillomavirus 16 p97 promoter and cooperates with high-risk E6/E7 for oxidative DNA damage in lung cells.PLoS One. 2015 Apr 1;10(4):e0123029. doi: 10.1371/journal.pone.0123029. eCollection 2015.
15 Functional cooperativity of p97 and histone deacetylase 6 in mediating DNA repair in mantle cell lymphoma cells.Leukemia. 2019 Jul;33(7):1675-1686. doi: 10.1038/s41375-018-0355-y. Epub 2019 Jan 21.
16 Novel cell line models to study mechanisms and overcoming strategies of proteasome inhibitor resistance in multiple myeloma.Biochim Biophys Acta Mol Basis Dis. 2019 Jun 1;1865(6):1666-1676. doi: 10.1016/j.bbadis.2019.04.003. Epub 2019 Apr 4.
17 The Interplay of Cofactor Interactions and Post-translational Modifications in the Regulation of the AAA+ ATPase p97.Front Mol Biosci. 2017 Apr 13;4:21. doi: 10.3389/fmolb.2017.00021. eCollection 2017.
18 CD38 and E2F transcription factor 2 have uniquely increased expression in rheumatoid arthritis synovial tissues.Clin Exp Immunol. 2014 May;176(2):222-31. doi: 10.1111/cei.12268.
19 VAPB/ALS8 interacts with FFAT-like proteins including the p97 cofactor FAF1 and the ASNA1 ATPase.BMC Biol. 2014 May 29;12:39. doi: 10.1186/1741-7007-12-39.
20 Late-onset autosomal dominant limb girdle muscular dystrophy and Paget's disease of bone unlinked to the VCP gene locus.J Neurol Sci. 2010 Apr 15;291(1-2):79-85. doi: 10.1016/j.jns.2009.12.008. Epub 2010 Feb 8.
21 p97: An Emerging Target for Cancer, Neurodegenerative Diseases, and Viral Infections.J Med Chem. 2020 Mar 12;63(5):1892-1907. doi: 10.1021/acs.jmedchem.9b01318. Epub 2019 Oct 9.
22 Novel Susceptibility Loci for Moyamoya Disease Revealed by a Genome-Wide Association Study.Stroke. 2018 Jan;49(1):11-18. doi: 10.1161/STROKEAHA.117.017430.
23 Position 97 of HLA-B, a residue implicated in pathogenesis of ankylosing spondylitis, plays a key role in cell surface free heavy chain expression.Ann Rheum Dis. 2017 Mar;76(3):593-601. doi: 10.1136/annrheumdis-2016-209512. Epub 2016 Aug 11.
24 Identification of the BCAR1-CFDP1-TMEM170A locus as a determinant of carotid intima-media thickness and coronary artery disease risk.Circ Cardiovasc Genet. 2012 Dec;5(6):656-65. doi: 10.1161/CIRCGENETICS.112.963660. Epub 2012 Nov 14.
25 VCP/p97 increases BMP signaling by accelerating ubiquitin ligase Smurf1 degradation.FASEB J. 2019 Feb;33(2):2928-2943. doi: 10.1096/fj.201801173R. Epub 2018 Oct 18.
26 CpG methylation of HPV 16 LCR at E2 binding site proximal to P97 is associated with cervical cancer in presence of intact E2.Virology. 2006 Oct 25;354(2):280-5. doi: 10.1016/j.virol.2006.06.018. Epub 2006 Aug 14.
27 Functional Analysis of a Carotid Intima-Media Thickness Locus Implicates BCAR1 and Suggests a Causal Variant.Circ Cardiovasc Genet. 2015 Oct;8(5):696-706. doi: 10.1161/CIRCGENETICS.115.001062. Epub 2015 Aug 14.
28 The Identification of Potential TherapeuticTargets for Cutaneous SquamousCell Carcinoma.J Invest Dermatol. 2020 Jun;140(6):1154-1165.e5. doi: 10.1016/j.jid.2019.09.024. Epub 2019 Nov 6.
29 Enterovirus 71 protease 2Apro and 3Cpro differentially inhibit the cellular endoplasmic reticulum-associated degradation (ERAD) pathway via distinct mechanisms, and enterovirus 71 hijacks ERAD component p97 to promote its replication.PLoS Pathog. 2017 Oct 6;13(10):e1006674. doi: 10.1371/journal.ppat.1006674. eCollection 2017 Oct.
30 Discrepancy Between Tumor Antigen Distribution and Radiolabeled Antibody Binding in a Nude Mouse Xenograft Model of Human Melanoma.Cancer Biother Radiopharm. 2017 Apr;32(3):83-89. doi: 10.1089/cbr.2016.2115. Epub 2017 Apr 5.
31 Detection and interpretation of shared genetic influences on 42 human traits.Nat Genet. 2016 Jul;48(7):709-17. doi: 10.1038/ng.3570. Epub 2016 May 16.
32 Crystal structure of the catalytic D2 domain of the AAA+ ATPase p97 reveals a putative helical split-washer-type mechanism for substrate unfolding.FEBS Lett. 2020 Mar;594(5):933-943. doi: 10.1002/1873-3468.13667. Epub 2019 Nov 22.
33 Imbalances in p97 co-factor interactions in human proteinopathy.EMBO Rep. 2010 Jun;11(6):479-85. doi: 10.1038/embor.2010.49. Epub 2010 Apr 23.
34 A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
35 Blood transcript immune signatures distinguish a subset of people with elevated serum ALT from others given acetaminophen. Clin Pharmacol Ther. 2016 Apr;99(4):432-41.
36 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
37 Acute hypersensitivity of pluripotent testicular cancer-derived embryonal carcinoma to low-dose 5-aza deoxycytidine is associated with global DNA Damage-associated p53 activation, anti-pluripotency and DNA demethylation. PLoS One. 2012;7(12):e53003. doi: 10.1371/journal.pone.0053003. Epub 2012 Dec 27.
38 Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
39 Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
40 Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
41 From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
42 Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.