Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT17IA9L)

DOT Name Cyclin-G1 (CCNG1)
Synonyms Cyclin-G
Gene Name CCNG1
Related Disease
Breast cancer ( )
Breast carcinoma ( )
Lung cancer ( )
Thyroid gland papillary carcinoma ( )
Advanced cancer ( )
Bone osteosarcoma ( )
Carcinoma ( )
Castration-resistant prostate carcinoma ( )
Endometrial carcinoma ( )
Epithelial ovarian cancer ( )
Esophageal squamous cell carcinoma ( )
Gastric cancer ( )
Hepatitis B virus infection ( )
Hepatocellular carcinoma ( )
Leiomyoma ( )
Lung neoplasm ( )
Mantle cell lymphoma ( )
Neoplasm ( )
Osteosarcoma ( )
Ovarian cancer ( )
Ovarian neoplasm ( )
Prostate cancer ( )
Prostate carcinoma ( )
Retinoblastoma ( )
Stomach cancer ( )
Triple negative breast cancer ( )
Uterine fibroids ( )
Lung carcinoma ( )
Nasopharyngeal carcinoma ( )
Neuroblastoma ( )
Prune belly syndrome ( )
Benign neoplasm ( )
Hepatitis C virus infection ( )
Matthew-Wood syndrome ( )
Pancreatic cancer ( )
Pancreatic ductal carcinoma ( )
Pituitary tumor ( )
UniProt ID
CCNG1_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF00134
Sequence
MIEVLTTTDSQKLLHQLNALLEQESRCQPKVCGLRLIESAHDNGLRMTARLRDFEVKDLL
SLTQFFGFDTETFSLAVNLLDRFLSKMKVQPKHLGCVGLSCFYLAVKSIEEERNVPLATD
LIRISQYRFTVSDLMRMEKIVLEKVCWKVKATTAFQFLQLYYSLLQENLPLERRNSINFE
RLEAQLKACHCRIIFSKAKPSVLALSIIALEIQAQKCVELTEGIECLQKHSKINGRDLTF
WQELVSKCLTEYSSNKCSKPNVQKLKWIVSGRTARQLKHSYYRITHLPTIPEMVP
Function May play a role in growth regulation. Is associated with G2/M phase arrest in response to DNA damage. May be an intermediate by which p53 mediates its role as an inhibitor of cellular proliferation.
Tissue Specificity High levels in skeletal muscle, ovary, kidney and colon.
KEGG Pathway
p53 sig.ling pathway (hsa04115 )
MicroR.s in cancer (hsa05206 )
Reactome Pathway
Regulation of TP53 Degradation (R-HSA-6804757 )

Molecular Interaction Atlas (MIA) of This DOT

37 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Breast cancer DIS7DPX1 Definitive Altered Expression [1]
Breast carcinoma DIS2UE88 Definitive Altered Expression [1]
Lung cancer DISCM4YA Definitive Biomarker [2]
Thyroid gland papillary carcinoma DIS48YMM Definitive Biomarker [3]
Advanced cancer DISAT1Z9 Strong Altered Expression [4]
Bone osteosarcoma DIST1004 Strong Biomarker [5]
Carcinoma DISH9F1N Strong Altered Expression [6]
Castration-resistant prostate carcinoma DISVGAE6 Strong Altered Expression [7]
Endometrial carcinoma DISXR5CY Strong Altered Expression [8]
Epithelial ovarian cancer DIS56MH2 Strong Altered Expression [4]
Esophageal squamous cell carcinoma DIS5N2GV Strong Biomarker [9]
Gastric cancer DISXGOUK Strong Biomarker [10]
Hepatitis B virus infection DISLQ2XY Strong Altered Expression [11]
Hepatocellular carcinoma DIS0J828 Strong Altered Expression [12]
Leiomyoma DISLDDFN Strong Biomarker [13]
Lung neoplasm DISVARNB Strong Biomarker [14]
Mantle cell lymphoma DISFREOV Strong Genetic Variation [15]
Neoplasm DISZKGEW Strong Biomarker [4]
Osteosarcoma DISLQ7E2 Strong Biomarker [5]
Ovarian cancer DISZJHAP Strong Altered Expression [4]
Ovarian neoplasm DISEAFTY Strong Altered Expression [4]
Prostate cancer DISF190Y Strong Biomarker [7]
Prostate carcinoma DISMJPLE Strong Biomarker [7]
Retinoblastoma DISVPNPB Strong Altered Expression [16]
Stomach cancer DISKIJSX Strong Biomarker [10]
Triple negative breast cancer DISAMG6N Strong Altered Expression [17]
Uterine fibroids DISBZRMJ Strong Biomarker [13]
Lung carcinoma DISTR26C moderate Biomarker [18]
Nasopharyngeal carcinoma DISAOTQ0 moderate Altered Expression [19]
Neuroblastoma DISVZBI4 moderate Altered Expression [20]
Prune belly syndrome DISBIBMN moderate Biomarker [21]
Benign neoplasm DISDUXAD Limited Altered Expression [22]
Hepatitis C virus infection DISQ0M8R Limited Altered Expression [23]
Matthew-Wood syndrome DISA7HR7 Limited Biomarker [24]
Pancreatic cancer DISJC981 Limited Biomarker [25]
Pancreatic ductal carcinoma DIS26F9Q Limited Altered Expression [24]
Pituitary tumor DISN67JD Limited Biomarker [26]
------------------------------------------------------------------------------------
⏷ Show the Full List of 37 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
21 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the expression of Cyclin-G1 (CCNG1). [27]
Tretinoin DM49DUI Approved Tretinoin decreases the expression of Cyclin-G1 (CCNG1). [28]
Doxorubicin DMVP5YE Approved Doxorubicin decreases the expression of Cyclin-G1 (CCNG1). [29]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate decreases the expression of Cyclin-G1 (CCNG1). [30]
Estradiol DMUNTE3 Approved Estradiol decreases the expression of Cyclin-G1 (CCNG1). [31]
Arsenic DMTL2Y1 Approved Arsenic increases the expression of Cyclin-G1 (CCNG1). [32]
Methotrexate DM2TEOL Approved Methotrexate increases the expression of Cyclin-G1 (CCNG1). [33]
Marinol DM70IK5 Approved Marinol increases the expression of Cyclin-G1 (CCNG1). [34]
Menadione DMSJDTY Approved Menadione affects the expression of Cyclin-G1 (CCNG1). [35]
Fluorouracil DMUM7HZ Approved Fluorouracil decreases the expression of Cyclin-G1 (CCNG1). [36]
Troglitazone DM3VFPD Approved Troglitazone decreases the expression of Cyclin-G1 (CCNG1). [37]
Menthol DMG2KW7 Approved Menthol decreases the expression of Cyclin-G1 (CCNG1). [38]
Hydroxyurea DMOQVU9 Approved Hydroxyurea increases the expression of Cyclin-G1 (CCNG1). [39]
Tamibarotene DM3G74J Phase 3 Tamibarotene affects the expression of Cyclin-G1 (CCNG1). [28]
Epigallocatechin gallate DMCGWBJ Phase 3 Epigallocatechin gallate increases the expression of Cyclin-G1 (CCNG1). [40]
PMID28460551-Compound-2 DM4DOUB Patented PMID28460551-Compound-2 increases the expression of Cyclin-G1 (CCNG1). [41]
Bisphenol A DM2ZLD7 Investigative Bisphenol A affects the expression of Cyclin-G1 (CCNG1). [42]
Trichostatin A DM9C8NX Investigative Trichostatin A affects the expression of Cyclin-G1 (CCNG1). [43]
Milchsaure DM462BT Investigative Milchsaure increases the expression of Cyclin-G1 (CCNG1). [44]
Deguelin DMXT7WG Investigative Deguelin increases the expression of Cyclin-G1 (CCNG1). [45]
3R14S-OCHRATOXIN A DM2KEW6 Investigative 3R14S-OCHRATOXIN A decreases the expression of Cyclin-G1 (CCNG1). [46]
------------------------------------------------------------------------------------
⏷ Show the Full List of 21 Drug(s)

References

1 Estrogen and progesterone promote breast cancer cell proliferation by inducing cyclin G1 expression.Braz J Med Biol Res. 2018 Jan 23;51(3):1-7. doi: 10.1590/1414-431X20175612.
2 miR-23b suppresses lung carcinoma cell proliferation through CCNG1.Oncol Lett. 2018 Oct;16(4):4317-4324. doi: 10.3892/ol.2018.9181. Epub 2018 Jul 20.
3 MicroRNA-23a inhibits the growth of papillary thyroid carcinoma via regulating cyclin G1.Eur Rev Med Pharmacol Sci. 2019 Apr;23(8):3431-3439. doi: 10.26355/eurrev_201904_17707.
4 CCNG1 (Cyclin G1) regulation by mutant-P53 via induction of Notch3 expression promotes high-grade serous ovarian cancer (HGSOC) tumorigenesis and progression.Cancer Med. 2019 Jan;8(1):351-362. doi: 10.1002/cam4.1812. Epub 2018 Dec 18.
5 MicroRNA-27a functions as an oncogene in human osteosarcoma by targeting CCNG1.Oncol Lett. 2018 Jan;15(1):1067-1071. doi: 10.3892/ol.2017.7389. Epub 2017 Nov 10.
6 Cyclin G1 is a target of miR-122a, a microRNA frequently down-regulated in human hepatocellular carcinoma.Cancer Res. 2007 Jul 1;67(13):6092-9. doi: 10.1158/0008-5472.CAN-06-4607.
7 MicroRNA-23b and microRNA-27b plus flutamide treatment enhances apoptosis rate and decreases CCNG1 expression in a castration-resistant prostate cancer cell line.Tumour Biol. 2018 Nov;40(11):1010428318803011. doi: 10.1177/1010428318803011.
8 Effects of expression of exogenous cyclin G1 on proliferation of human endometrial carcinoma cells.Chin J Physiol. 2013 Apr 30;56(2):83-9. doi: 10.4077/CJP.2013.BAA079.
9 miR-516b functions as a tumor suppressor by directly modulating CCNG1 expression in esophageal squamous cell carcinoma.Biomed Pharmacother. 2018 Oct;106:1650-1660. doi: 10.1016/j.biopha.2018.07.074. Epub 2018 Jul 29.
10 The miR27b-CCNG1-P53-miR-508-5p axis regulates multidrug resistance of gastric cancer.Oncotarget. 2016 Jan 5;7(1):538-49. doi: 10.18632/oncotarget.6374.
11 Loss of microRNA 122 expression in patients with hepatitis B enhances hepatitis B virus replication through cyclin G(1) -modulated P53 activity.Hepatology. 2012 Mar;55(3):730-41. doi: 10.1002/hep.24809.
12 LncRNA HOTAIR epigenetically suppresses miR-122 expression in hepatocellular carcinoma via DNA methylation.EBioMedicine. 2018 Oct;36:159-170. doi: 10.1016/j.ebiom.2018.08.055. Epub 2018 Sep 5.
13 Increased expression of cyclin G1 in leiomyoma compared with normal myometrium.Am J Obstet Gynecol. 2003 Mar;188(3):634-9. doi: 10.1067/mob.2003.140.
14 Gene expression analysis of urethane-induced lung tumors in ras H2 mice.Toxicology. 2006 Jan 16;217(2-3):129-38. doi: 10.1016/j.tox.2005.09.021. Epub 2005 Nov 14.
15 Rearrangement of CCND1 (BCL1/PRAD1) 3' untranslated region in mantle-cell lymphomas and t(11q13)-associated leukemias.Blood. 1994 Jun 15;83(12):3689-96.
16 Retroviral vector-mediated gene transfer of antisense cyclin G1 (CYCG1) inhibits proliferation of human osteogenic sarcoma cells.Cancer Res. 1995 Dec 1;55(23):5493-8.
17 CyclinG1 Amplification Enhances Aurora Kinase Inhibitor-Induced Polyploid Resistance and Inhibition of Bcl-2 Pathway Reverses the Resistance.Cell Physiol Biochem. 2017;43(1):94-107. doi: 10.1159/000480322. Epub 2017 Aug 25.
18 Erratum: miR-23b suppresses lung carcinoma cell proliferation through CCNG1.Oncol Lett. 2019 Feb;17(2):2005. doi: 10.3892/ol.2018.9790. Epub 2018 Dec 4.
19 The expression of cyclin G in nasopharyngeal carcinoma and its significance.Clin Exp Med. 2012 Mar;12(1):21-4. doi: 10.1007/s10238-011-0142-9. Epub 2011 Jun 19.
20 Interleukin-18 increases expression of kinases involved in tau phosphorylation in SH-SY5Y neuroblastoma cells.J Neuroimmunol. 2008 Dec 15;205(1-2):86-93. doi: 10.1016/j.jneuroim.2008.09.012. Epub 2008 Oct 22.
21 Inhibition of metastatic tumor growth in nude mice by portal vein infusions of matrix-targeted retroviral vectors bearing a cytocidal cyclin G1 construct.Cancer Res. 2000 Jul 1;60(13):3343-7.
22 MiR-23b targets cyclin G1 and suppresses ovarian cancer tumorigenesis and progression.J Exp Clin Cancer Res. 2016 Feb 13;35:31. doi: 10.1186/s13046-016-0307-1.
23 Can tobacco use promote HCV-induced miR-122 hijacking and hepatocarcinogenesis?.Med Hypotheses. 2013 Feb;80(2):131-3. doi: 10.1016/j.mehy.2012.11.009. Epub 2012 Dec 5.
24 The C/EBP-LINC01133 axis promotes cell proliferation in pancreatic ductal adenocarcinoma through upregulation of CCNG1.Cancer Lett. 2018 May 1;421:63-72. doi: 10.1016/j.canlet.2018.02.020. Epub 2018 Feb 16.
25 A Phase I-II Study Using Rexin-G Tumor-Targeted Retrovector Encoding a Dominant-Negative Cyclin G1 Inhibitor for Advanced Pancreatic Cancer.Mol Ther Oncolytics. 2018 Dec 14;12:56-67. doi: 10.1016/j.omto.2018.12.005. eCollection 2019 Mar 29.
26 Antitumor function of microRNA-122 against hepatocellular carcinoma.J Gastroenterol. 2014 Apr;49(4):589-93. doi: 10.1007/s00535-014-0932-4. Epub 2014 Feb 17.
27 Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
28 Differential modulation of PI3-kinase/Akt pathway during all-trans retinoic acid- and Am80-induced HL-60 cell differentiation revealed by DNA microarray analysis. Biochem Pharmacol. 2004 Dec 1;68(11):2177-86.
29 Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
30 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
31 Gene expression profiling reveals novel regulation by bisphenol-A in estrogen receptor-alpha-positive human cells. Environ Res. 2006 Jan;100(1):86-92.
32 Application of cDNA microarray to the study of arsenic-induced liver diseases in the population of Guizhou, China. Toxicol Sci. 2001 Jan;59(1):185-92.
33 Functional gene expression profile underlying methotrexate-induced senescence in human colon cancer cells. Tumour Biol. 2011 Oct;32(5):965-76.
34 JunD is involved in the antiproliferative effect of Delta9-tetrahydrocannabinol on human breast cancer cells. Oncogene. 2008 Aug 28;27(37):5033-44.
35 Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
36 Cellular response to 5-fluorouracil (5-FU) in 5-FU-resistant colon cancer cell lines during treatment and recovery. Mol Cancer. 2006 May 18;5:20. doi: 10.1186/1476-4598-5-20.
37 Increased sensitivity for troglitazone-induced cytotoxicity using a human in vitro co-culture model. Toxicol In Vitro. 2009 Oct;23(7):1387-95.
38 Repurposing L-menthol for systems medicine and cancer therapeutics? L-menthol induces apoptosis through caspase 10 and by suppressing HSP90. OMICS. 2016 Jan;20(1):53-64.
39 Hydroxyurea (HU)-induced apoptosis in the mouse fetal lung. Exp Mol Pathol. 2005 Aug;79(1):59-67. doi: 10.1016/j.yexmp.2005.02.007. Epub 2005 Apr 22.
40 Impact of epigallocatechin gallate on gene expression profiles of human hepatocellular carcinoma cell lines BEL7404/ADM and BEL7402/5-FU. Ai Zheng. 2008 Oct;27(10):1056-64.
41 Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
42 Comprehensive analysis of transcriptomic changes induced by low and high doses of bisphenol A in HepG2 spheroids in vitro and rat liver in vivo. Environ Res. 2019 Jun;173:124-134. doi: 10.1016/j.envres.2019.03.035. Epub 2019 Mar 18.
43 A trichostatin A expression signature identified by TempO-Seq targeted whole transcriptome profiling. PLoS One. 2017 May 25;12(5):e0178302. doi: 10.1371/journal.pone.0178302. eCollection 2017.
44 Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
45 Neurotoxicity and underlying cellular changes of 21 mitochondrial respiratory chain inhibitors. Arch Toxicol. 2021 Feb;95(2):591-615. doi: 10.1007/s00204-020-02970-5. Epub 2021 Jan 29.
46 Ochratoxin a lowers mRNA levels of genes encoding for key proteins of liver cell metabolism. Cancer Genomics Proteomics. 2008 Nov-Dec;5(6):319-32.