Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT1DPZAE)

• DOT Name: Nuclear factor 1 X-type (NFIX)
• Synonyms: NF1-X; Nuclear factor 1/X; CCAAT-box-binding transcription factor; CTF; Nuclear factor I/X; NF-I/X; NFI-X; TGGCA-binding protein
• Gene Name: NFIX
• Related Disease:
  Bone development disease
  Malan overgrowth syndrome
  Marshall-Smith syndrome
  Amyloidosis
  Breast carcinoma
  Dementia
  Diabetic kidney disease
  Esophageal squamous cell carcinoma
  Gastric cancer
  Glioma
  Herpes simplex infection
  Lung adenocarcinoma
  Lung squamous cell carcinoma
  Neurofibromatosis type 1
  Overgrowth syndrome
  Schwannomatosis
  Systemic sclerosis
  Bipolar disorder
  Neuroblastoma
  Neurofibromatosis
  Hydrocephalus
  Intervertebral disc degeneration
  Megalencephaly
  Neoplasm
  Alzheimer disease
  Bladder cancer
  Epithelial ovarian cancer
  Intellectual disability
  Marinesco-Sjogren syndrome
  Prostate cancer
  Prostate carcinoma
  Urinary bladder cancer
  Urinary bladder neoplasm
• UniProt ID: NFIX_HUMAN
• PDB ID: 7QQD; 7QQE
• Pfam ID: PF00859 ; PF03165 ; PF10524
• Sequence:
  MYSPYCLTQDEFHPFIEALLPHVRAFSYTWFNLQARKRKYFKKHEKRMSKDEERAVKDEL
  LGEKPEIKQKWASRLLAKLRKDIRPEFREDFVLTITGKKPPCCVLSNPDQKGKIRRIDCL
  RQADKVWRLDLVMVILFKGIPLESTDGERLYKSPQCSNPGLCVQPHHIGVTIKELDLYLA
  YFVHTPESGQSDSSNQQGDADIKPLPNGHLSFQDCFVTSGVWNVTELVRVSQTPVATASG
  PNFSLADLESPSYYNINQVTLGRRSITSPPSTSTTKRPKSIDDSEMESPVDDVFYPGTGR
  SPAAGSSQSSGWPNDVDAGPASLKKSGKLDFCSALSSQGSSPRMAFTHHPLPVLAGVRPG
  SPRATASALHFPSTSIIQQSSPYFTHPTIRYHHHHGQDSLKEFVQFVCSDGSGQATGQPN
  GSGQGKVPGSFLLPPPPPVARPVPLPMPDSKSTSTAPDGAALTPPSPSFATTGASSANRF
  VSIGPRDGNFLNIPQQSQSWFL
• Function: Recognizes and binds the palindromic sequence 5'-TTGGCNNNNNGCCAA-3' present in viral and cellular promoters and in the origin of replication of adenovirus type 2. These proteins are individually capable of activating transcription and replication.
• Tissue Specificity: Widely expressed.
• Reactome Pathway:
  RNA Polymerase III Abortive And Retractive Initiation (R-HSA-749476)
  RNA Polymerase III Transcription Termination (R-HSA-73980)

Molecular Interaction Atlas (MIA) of This DOT

33 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Bone development disease	DISVKAZS	Definitive	Genetic Variation	[1]
Malan overgrowth syndrome	DIS37600	Definitive	Autosomal dominant	[2]
Marshall-Smith syndrome	DIS8BYL7	Definitive	Autosomal dominant	[2]
Amyloidosis	DISHTAI2	Strong	Biomarker	[3]
Breast carcinoma	DIS2UE88	Strong	Genetic Variation	[4]
Dementia	DISXL1WY	Strong	Biomarker	[5]
Diabetic kidney disease	DISJMWEY	Strong	Biomarker	[6]
Esophageal squamous cell carcinoma	DIS5N2GV	Strong	Altered Expression	[7]
Gastric cancer	DISXGOUK	Strong	Altered Expression	[8]
Glioma	DIS5RPEH	Strong	Biomarker	[9]
Herpes simplex infection	DISL1SAV	Strong	Altered Expression	[10]
Lung adenocarcinoma	DISD51WR	Strong	Altered Expression	[11]
Lung squamous cell carcinoma	DISXPIBD	Strong	Altered Expression	[11]
Neurofibromatosis type 1	DIS53JH9	Strong	Biomarker	[12]
Overgrowth syndrome	DISHK54G	Strong	Biomarker	[13]
Schwannomatosis	DISDWAM1	Strong	Biomarker	[14]
Systemic sclerosis	DISF44L6	Strong	Biomarker	[15]
Bipolar disorder	DISAM7J2	moderate	Genetic Variation	[16]
Neuroblastoma	DISVZBI4	moderate	Biomarker	[17]
Neurofibromatosis	DIS5N2R6	moderate	Biomarker	[12]
Hydrocephalus	DISIZUF7	Disputed	Biomarker	[18]
Intervertebral disc degeneration	DISG3AIM	Disputed	Biomarker	[18]
Megalencephaly	DISYW5SV	Disputed	Genetic Variation	[19]
Neoplasm	DISZKGEW	Disputed	Altered Expression	[20]
Alzheimer disease	DISF8S70	Limited	Biomarker	[21]
Bladder cancer	DISUHNM0	Limited	Biomarker	[22]
Epithelial ovarian cancer	DIS56MH2	Limited	Altered Expression	[23]
Intellectual disability	DISMBNXP	Limited	Genetic Variation	[19]
Marinesco-Sjogren syndrome	DISKEU0B	Limited	Genetic Variation	[24]
Prostate cancer	DISF190Y	Limited	Biomarker	[22]
Prostate carcinoma	DISMJPLE	Limited	Biomarker	[22]
Urinary bladder cancer	DISDV4T7	Limited	Biomarker	[22]
Urinary bladder neoplasm	DIS7HACE	Limited	Biomarker	[22]

This DOT Affected the Drug Response of 2 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Temozolomide	DMKECZD	Approved	Nuclear factor 1 X-type (NFIX) affects the response to substance of Temozolomide.	[47]
DTI-015	DMXZRW0	Approved	Nuclear factor 1 X-type (NFIX) affects the response to substance of DTI-015.	[47]

4 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Nuclear factor 1 X-type (NFIX).	[25]
Arsenic	DMTL2Y1	Approved	Arsenic affects the methylation of Nuclear factor 1 X-type (NFIX).	[31]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene affects the methylation of Nuclear factor 1 X-type (NFIX).	[40]
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 decreases the phosphorylation of Nuclear factor 1 X-type (NFIX).	[43]

19 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Nuclear factor 1 X-type (NFIX).	[26]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Nuclear factor 1 X-type (NFIX).	[27]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Nuclear factor 1 X-type (NFIX).	[28]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of Nuclear factor 1 X-type (NFIX).	[29]
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of Nuclear factor 1 X-type (NFIX).	[30]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide decreases the expression of Nuclear factor 1 X-type (NFIX).	[32]
Triclosan	DMZUR4N	Approved	Triclosan increases the expression of Nuclear factor 1 X-type (NFIX).	[33]
Methotrexate	DM2TEOL	Approved	Methotrexate increases the expression of Nuclear factor 1 X-type (NFIX).	[34]
Decitabine	DMQL8XJ	Approved	Decitabine decreases the expression of Nuclear factor 1 X-type (NFIX).	[35]
Marinol	DM70IK5	Approved	Marinol increases the expression of Nuclear factor 1 X-type (NFIX).	[36]
Niclosamide	DMJAGXQ	Approved	Niclosamide increases the expression of Nuclear factor 1 X-type (NFIX).	[37]
Bosentan	DMIOGBU	Approved	Bosentan decreases the expression of Nuclear factor 1 X-type (NFIX).	[38]
Resveratrol	DM3RWXL	Phase 3	Resveratrol increases the expression of Nuclear factor 1 X-type (NFIX).	[39]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Nuclear factor 1 X-type (NFIX).	[41]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Nuclear factor 1 X-type (NFIX).	[42]
UNC0379	DMD1E4J	Preclinical	UNC0379 decreases the expression of Nuclear factor 1 X-type (NFIX).	[44]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde increases the expression of Nuclear factor 1 X-type (NFIX).	[45]
4-hydroxy-2-nonenal	DM2LJFZ	Investigative	4-hydroxy-2-nonenal decreases the expression of Nuclear factor 1 X-type (NFIX).	[32]
Manganese	DMKT129	Investigative	Manganese decreases the expression of Nuclear factor 1 X-type (NFIX).	[46]

References

• [1] Variants in nuclear factor I genes influence growth and development.Am J Med Genet C Semin Med Genet. 2019 Dec;181(4):611-626. doi: 10.1002/ajmg.c.31747. Epub 2019 Nov 15.
• [2] Technical standards for the interpretation and reporting of constitutional copy-number variants: a joint consensus recommendation of the American College of Medical Genetics and Genomics (ACMG) and the Clinical Genome Resource (ClinGen). Genet Med. 2020 Feb;22(2):245-257. doi: 10.1038/s41436-019-0686-8. Epub 2019 Nov 6.
• [3] Age-Related Intraneuronal Aggregation of Amyloid- in Endosomes, Mitochondria, Autophagosomes, and Lysosomes.J Alzheimers Dis. 2020;73(1):229-246. doi: 10.3233/JAD-190835.
• [4] Association analysis identifies 65 new breast cancer risk loci.Nature. 2017 Nov 2;551(7678):92-94. doi: 10.1038/nature24284. Epub 2017 Oct 23.
• [5] - but not -secretase proteolysis of APP causes synaptic and memory deficits in a mouse model of dementia.EMBO Mol Med. 2012 Mar;4(3):171-9. doi: 10.1002/emmm.201100195. Epub 2012 Jan 23.
• [6] Cell adhesion molecule-1 shedding induces apoptosis of renal epithelial cells and exacerbates human nephropathies.Am J Physiol Renal Physiol. 2018 Mar 1;314(3):F388-F398. doi: 10.1152/ajprenal.00385.2017. Epub 2017 Oct 25.
• [7] MiR-1290 promotes cancer progression by targeting nuclear factor I/X(NFIX) in esophageal squamous cell carcinoma (ESCC).Biomed Pharmacother. 2015 Dec;76:82-93. doi: 10.1016/j.biopha.2015.10.005. Epub 2015 Nov 10.
• [8] BCL6 degradation caused by the interaction with the C-terminus of pro-HB-EGF induces cyclin D2 expression in gastric cancers.Br J Cancer. 2009 Apr 21;100(8):1320-9. doi: 10.1038/sj.bjc.6605010. Epub 2009 Mar 31.
• [9] NFIX Circular RNA Promotes Glioma Progression by Regulating miR-34a-5p via Notch Signaling Pathway.Front Mol Neurosci. 2018 Jul 18;11:225. doi: 10.3389/fnmol.2018.00225. eCollection 2018.
• [10] Two transcriptional activators, CCAAT-box-binding transcription factor and heat shock transcription factor, interact with a human hsp70 gene promoter.Mol Cell Biol. 1987 Mar;7(3):1129-38. doi: 10.1128/mcb.7.3.1129-1138.1987.
• [11] NFIX downregulation independently predicts poor prognosis in lung adenocarcinoma, but not in squamous cell carcinoma.Future Oncol. 2018 Dec;14(30):3135-3144. doi: 10.2217/fon-2018-0164. Epub 2018 Nov 12.
• [12] Characterization and utilization of an international neurofibromatosis web-based, patient-entered registry: An observational study.PLoS One. 2017 Jun 23;12(6):e0178639. doi: 10.1371/journal.pone.0178639. eCollection 2017.
• [13] NFIX mutations affecting the DNA-binding domain cause a peculiar overgrowth syndrome (Malan syndrome): a new patients series.Eur J Med Genet. 2015 Sep;58(9):488-91. doi: 10.1016/j.ejmg.2015.06.009. Epub 2015 Jul 17.
• [14] CTF meeting 2012: Translation of the basic understanding of the biology and genetics of NF1, NF2, and schwannomatosis toward the development of effective therapies.Am J Med Genet A. 2014 Mar;164A(3):563-78. doi: 10.1002/ajmg.a.36312. Epub 2014 Jan 17.
• [15] CCAAT binding transcription factor binds and regulates human COL1A1 promoter activity in human dermal fibroblasts: demonstration of increased binding in systemic sclerosis fibroblasts.Arthritis Rheum. 2000 Oct;43(10):2219-29. doi: 10.1002/1529-0131(200010)43:10<2219::AID-ANR9>3.0.CO;2-N.
• [16] A genome-wide association study identifies two novel susceptibility loci and trans population polygenicity associated with bipolar disorder.Mol Psychiatry. 2018 Mar;23(3):639-647. doi: 10.1038/mp.2016.259. Epub 2017 Jan 24.
• [17] Evidence that intramolecular associations between presenilin domains are obligatory for endoproteolytic processing.J Biol Chem. 1999 May 14;274(20):13818-23. doi: 10.1074/jbc.274.20.13818.
• [18] Nuclear factor I X deficiency causes brain malformation and severe skeletal defects. Mol Cell Biol. 2007 May;27(10):3855-3867. doi: 10.1128/MCB.02293-06.
• [19] 19p13 microduplications encompassing NFIX are responsible for intellectual disability, short stature and small head circumference.Eur J Hum Genet. 2018 Jan;26(1):85-93. doi: 10.1038/s41431-017-0037-7. Epub 2017 Nov 28.
• [20] Targeted therapy of DNA tumor virus-associated cancers using virus-activated transcription factors.Mol Ther. 2006 May;13(5):899-909. doi: 10.1016/j.ymthe.2005.11.023. Epub 2006 Feb 3.
• [21] NRBF2 is involved in the autophagic degradation process of APP-CTFs in Alzheimer disease models.Autophagy. 2017;13(12):2028-2040. doi: 10.1080/15548627.2017.1379633.
• [22] Androgen receptor suppresses prostate cancer metastasis but promotes bladder cancer metastasis via differentially altering miRNA525-5p/SLPI-mediated vasculogenic mimicry formation.Cancer Lett. 2020 Mar 31;473:118-129. doi: 10.1016/j.canlet.2019.12.018. Epub 2019 Dec 13.
• [23] NF-YA underlies EZH2 upregulation and is essential for proliferation of human epithelial ovarian cancer cells.Mol Cancer Res. 2013 Apr;11(4):360-9. doi: 10.1158/1541-7786.MCR-12-0661. Epub 2013 Jan 29.
• [24] Malan syndrome: Extension of genotype and phenotype spectrum.Am J Med Genet A. 2018 Dec;176(12):2896-2900. doi: 10.1002/ajmg.a.40663. Epub 2018 Dec 10.
• [25] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [26] Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
• [27] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [28] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [29] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [30] 17-Estradiol Activates HSF1 via MAPK Signaling in ER-Positive Breast Cancer Cells. Cancers (Basel). 2019 Oct 11;11(10):1533. doi: 10.3390/cancers11101533.
• [31] Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
• [32] Microarray analysis of H2O2-, HNE-, or tBH-treated ARPE-19 cells. Free Radic Biol Med. 2002 Nov 15;33(10):1419-32.
• [33] Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
• [34] Global molecular effects of tocilizumab therapy in rheumatoid arthritis synovium. Arthritis Rheumatol. 2014 Jan;66(1):15-23.
• [35] DNA methylation inhibits p53-mediated survivin repression. Oncogene. 2009 May 14;28(19):2046-50. doi: 10.1038/onc.2009.62. Epub 2009 Apr 13.
• [36] THC exposure of human iPSC neurons impacts genes associated with neuropsychiatric disorders. Transl Psychiatry. 2018 Apr 25;8(1):89. doi: 10.1038/s41398-018-0137-3.
• [37] Mitochondrial Uncoupling Induces Epigenome Remodeling and Promotes Differentiation in Neuroblastoma. Cancer Res. 2023 Jan 18;83(2):181-194. doi: 10.1158/0008-5472.CAN-22-1029.
• [38] Omics-based responses induced by bosentan in human hepatoma HepaRG cell cultures. Arch Toxicol. 2018 Jun;92(6):1939-1952.
• [39] Interactive gene expression pattern in prostate cancer cells exposed to phenolic antioxidants. Life Sci. 2002 Mar 1;70(15):1821-39.
• [40] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [41] Inhibition of BRD4 attenuates tumor cell self-renewal and suppresses stem cell signaling in MYC driven medulloblastoma. Oncotarget. 2014 May 15;5(9):2355-71.
• [42] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [43] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [44] Epigenetic siRNA and chemical screens identify SETD8 inhibition as a therapeutic strategy for p53 activation in high-risk neuroblastoma. Cancer Cell. 2017 Jan 9;31(1):50-63.
• [45] Cellular reactions to long-term volatile organic compound (VOC) exposures. Sci Rep. 2016 Dec 1;6:37842. doi: 10.1038/srep37842.
• [46] Gene expression profiling of human primary astrocytes exposed to manganese chloride indicates selective effects on several functions of the cells. Neurotoxicology. 2007 May;28(3):478-89.
• [47] Tumor necrosis factor-alpha-induced protein 3 as a putative regulator of nuclear factor-kappaB-mediated resistance to O6-alkylating agents in human glioblastomas. J Clin Oncol. 2006 Jan 10;24(2):274-87. doi: 10.1200/JCO.2005.02.9405. Epub 2005 Dec 19.