Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT3YNCH1)

• DOT Name: Myosin-6 (MYH6)
• Synonyms: Myosin heavy chain 6; Myosin heavy chain, cardiac muscle alpha isoform; MyHC-alpha
• Gene Name: MYH6
• Related Disease:
  Breast cancer
  Breast carcinoma
  Non-insulin dependent diabetes
  Advanced cancer
  Alzheimer disease
  Atrial fibrillation
  Atrial septal defect
  Cardiomyopathy
  Colorectal carcinoma
  Congestive heart failure
  Deafness
  Dilated cardiomyopathy 1A
  Epithelial ovarian cancer
  Familial dilated cardiomyopathy
  Hepatocellular carcinoma
  High blood pressure
  Hypertrophic cardiomyopathy 14
  Hypoplastic left heart syndrome
  Hypoplastic left heart syndrome 1
  Hypothyroidism
  Myocardial infarction
  Myopathy
  Neoplasm
  Obesity
  Ovarian cancer
  Ovarian neoplasm
  Sensorineural hearing loss disorder
  Sick sinus syndrome
  Sinoatrial node disorder
  Stroke
  Cardiac failure
  Familial atrial fibrillation
  Familial hypertrophic cardiomyopathy
  Keppen-Lubinsky syndrome
  Lung cancer
  Lung carcinoma
  Melanoma
  Wolff-Parkinson-White syndrome
  Obsolete familial isolated dilated cardiomyopathy
  Amyotrophic lateral sclerosis
  Arrhythmia
  Atrial septal defect 3
  Dilated cardiomyopathy
  Hypertrophic cardiomyopathy
  Hypertrophic cardiomyopathy 1
  Prostate cancer
  Prostate carcinoma
• UniProt ID: MYH6_HUMAN
• Pfam ID: PF00063 ; PF02736 ; PF01576
• Sequence:
  MTDAQMADFGAAAQYLRKSEKERLEAQTRPFDIRTECFVPDDKEEFVKAKILSREGGKVI
  AETENGKTVTVKEDQVLQQNPPKFDKIEDMAMLTFLHEPAVLFNLKERYAAWMIYTYSGL
  FCVTVNPYKWLPVYNAEVVAAYRGKKRSEAPPHIFSISDNAYQYMLTDRENQSILITGES
  GAGKTVNTKRVIQYFASIAAIGDRGKKDNANANKGTLEDQIIQANPALEAFGNAKTVRND
  NSSRFGKFIRIHFGATGKLASADIETYLLEKSRVIFQLKAERNYHIFYQILSNKKPELLD
  MLLVTNNPYDYAFVSQGEVSVASIDDSEELMATDSAFDVLGFTSEEKAGVYKLTGAIMHY
  GNMKFKQKQREEQAEPDGTEDADKSAYLMGLNSADLLKGLCHPRVKVGNEYVTKGQSVQQ
  VYYSIGALAKAVYEKMFNWMVTRINATLETKQPRQYFIGVLDIAGFEIFDFNSFEQLCIN
  FTNEKLQQFFNHHMFVLEQEEYKKEGIEWTFIDFGMDLQACIDLIEKPMGIMSILEEECM
  FPKATDMTFKAKLYDNHLGKSNNFQKPRNIKGKQEAHFSLIHYAGTVDYNILGWLEKNKD
  PLNETVVALYQKSSLKLMATLFSSYATADTGDSGKSKGGKKKGSSFQTVSALHRENLNKL
  MTNLRTTHPHFVRCIIPNERKAPGVMDNPLVMHQLRCNGVLEGIRICRKGFPNRILYGDF
  RQRYRILNPVAIPEGQFIDSRKGTEKLLSSLDIDHNQYKFGHTKVFFKAGLLGLLEEMRD
  ERLSRIITRMQAQARGQLMRIEFKKIVERRDALLVIQWNIRAFMGVKNWPWMKLYFKIKP
  LLKSAETEKEMATMKEEFGRIKETLEKSEARRKELEEKMVSLLQEKNDLQLQVQAEQDNL
  NDAEERCDQLIKNKIQLEAKVKEMNERLEDEEEMNAELTAKKRKLEDECSELKKDIDDLE
  LTLAKVEKEKHATENKVKNLTEEMAGLDEIIAKLTKEKKALQEAHQQALDDLQVEEDKVN
  SLSKSKVKLEQQVDDLEGSLEQEKKVRMDLERAKRKLEGDLKLTQESIMDLENDKLQLEE
  KLKKKEFDINQQNSKIEDEQVLALQLQKKLKENQARIEELEEELEAERTARAKVEKLRSD
  LSRELEEISERLEEAGGATSVQIEMNKKREAEFQKMRRDLEEATLQHEATAAALRKKHAD
  SVAELGEQIDNLQRVKQKLEKEKSEFKLELDDVTSNMEQIIKAKANLEKVSRTLEDQANE
  YRVKLEEAQRSLNDFTTQRAKLQTENGELARQLEEKEALISQLTRGKLSYTQQMEDLKRQ
  LEEEGKAKNALAHALQSARHDCDLLREQYEEETEAKAELQRVLSKANSEVAQWRTKYETD
  AIQRTEELEEAKKKLAQRLQDAEEAVEAVNAKCSSLEKTKHRLQNEIEDLMVDVERSNAA
  AAALDKKQRNFDKILAEWKQKYEESQSELESSQKEARSLSTELFKLKNAYEESLEHLETF
  KRENKNLQEEISDLTEQLGEGGKNVHELEKVRKQLEVEKLELQSALEEAEASLEHEEGKI
  LRAQLEFNQIKAEIERKLAEKDEEMEQAKRNHQRVVDSLQTSLDAETRSRNEVLRVKKKM
  EGDLNEMEIQLSHANRMAAEAQKQVKSLQSLLKDTQIQLDDAVRANDDLKENIAIVERRN
  NLLQAELEELRAVVEQTERSRKLAEQELIETSERVQLLHSQNTSLINQKKKMESDLTQLQ
  SEVEEAVQECRNAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKKNMEQTIKDLQHRLD
  EAEQIALKGGKKQLQKLEARVRELEGELEAEQKRNAESVKGMRKSERRIKELTYQTEEDK
  KNLLRLQDLVDKLQLKVKAYKRQAEEAEEQANTNLSKFRKVQHELDEAEERADIAESQVN
  KLRAKSRDIGAKQKMHDEE
• Function: Muscle contraction.
• KEGG Pathway:
  cGMP-PKG sig.ling pathway (hsa04022)
  Cardiac muscle contraction (hsa04260)
  Adrenergic sig.ling in cardiomyocytes (hsa04261)
  Motor proteins (hsa04814)
  Cytoskeleton in muscle cells (hsa04820)
  Thyroid hormone sig.ling pathway (hsa04919)
  Hypertrophic cardiomyopathy (hsa05410)
  Dilated cardiomyopathy (hsa05414)
  Viral myocarditis (hsa05416)
• Reactome Pathway: Striated Muscle Contraction (R-HSA-390522)

Molecular Interaction Atlas (MIA) of This DOT

47 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Breast cancer	DIS7DPX1	Definitive	Biomarker	[1]
Breast carcinoma	DIS2UE88	Definitive	Biomarker	[1]
Non-insulin dependent diabetes	DISK1O5Z	Definitive	Altered Expression	[2]
Advanced cancer	DISAT1Z9	Strong	Biomarker	[3]
Alzheimer disease	DISF8S70	Strong	Biomarker	[4]
Atrial fibrillation	DIS15W6U	Strong	Genetic Variation	[5]
Atrial septal defect	DISJT76B	Strong	Genetic Variation	[6]
Cardiomyopathy	DISUPZRG	Strong	Genetic Variation	[7]
Colorectal carcinoma	DIS5PYL0	Strong	Altered Expression	[8]
Congestive heart failure	DIS32MEA	Strong	Biomarker	[9]
Deafness	DISKCLH4	Strong	Biomarker	[10]
Dilated cardiomyopathy 1A	DIS0RK9Z	Strong	Biomarker	[11]
Epithelial ovarian cancer	DIS56MH2	Strong	Biomarker	[12]
Familial dilated cardiomyopathy	DISBHDU9	Strong	GermlineCausalMutation	[13]
Hepatocellular carcinoma	DIS0J828	Strong	Biomarker	[14]
High blood pressure	DISY2OHH	Strong	Biomarker	[15]
Hypertrophic cardiomyopathy 14	DISO7LHK	Strong	Autosomal dominant	[16]
Hypoplastic left heart syndrome	DISSLFZ4	Strong	Genetic Variation	[17]
Hypoplastic left heart syndrome 1	DISW3OY8	Strong	Genetic Variation	[17]
Hypothyroidism	DISR0H6D	Strong	Biomarker	[18]
Myocardial infarction	DIS655KI	Strong	Biomarker	[19]
Myopathy	DISOWG27	Strong	Biomarker	[20]
Neoplasm	DISZKGEW	Strong	Biomarker	[21]
Obesity	DIS47Y1K	Strong	Biomarker	[15]
Ovarian cancer	DISZJHAP	Strong	Biomarker	[12]
Ovarian neoplasm	DISEAFTY	Strong	Biomarker	[12]
Sensorineural hearing loss disorder	DISJV45Z	Strong	Genetic Variation	[22]
Sick sinus syndrome	DIS5AOLK	Strong	Genetic Variation	[23]
Sinoatrial node disorder	DISYJI6J	Strong	Biomarker	[24]
Stroke	DISX6UHX	Strong	Biomarker	[25]
Cardiac failure	DISDC067	moderate	Biomarker	[9]
Familial atrial fibrillation	DISL4AGF	moderate	Biomarker	[5]
Familial hypertrophic cardiomyopathy	DISQ89HN	moderate	Genetic Variation	[26]
Keppen-Lubinsky syndrome	DISADE3A	Moderate	Autosomal dominant	[27]
Lung cancer	DISCM4YA	moderate	Biomarker	[28]
Lung carcinoma	DISTR26C	moderate	Biomarker	[28]
Melanoma	DIS1RRCY	moderate	Biomarker	[29]
Wolff-Parkinson-White syndrome	DISW4TQ8	moderate	Genetic Variation	[30]
Obsolete familial isolated dilated cardiomyopathy	DIS4FXO4	Supportive	Autosomal dominant	[31]
Amyotrophic lateral sclerosis	DISF7HVM	Limited	Genetic Variation	[32]
Arrhythmia	DISFF2NI	Limited	Biomarker	[33]
Atrial septal defect 3	DISCFPU5	Limited	Autosomal dominant	[16]
Dilated cardiomyopathy	DISX608J	Limited	Autosomal dominant	[34]
Hypertrophic cardiomyopathy	DISQG2AI	Limited	Autosomal dominant	[34]
Hypertrophic cardiomyopathy 1	DISFOPCJ	Limited	CausalMutation	[35]
Prostate cancer	DISF190Y	Limited	Biomarker	[36]
Prostate carcinoma	DISMJPLE	Limited	Biomarker	[29]

This DOT Affected the Drug Response of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Warfarin	DMJYCVW	Approved	Myosin-6 (MYH6) affects the response to substance of Warfarin.	[48]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Myosin-6 (MYH6).	[37]

14 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Myosin-6 (MYH6).	[38]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Myosin-6 (MYH6).	[39]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide increases the expression of Myosin-6 (MYH6).	[40]
Triclosan	DMZUR4N	Approved	Triclosan decreases the expression of Myosin-6 (MYH6).	[41]
Dexamethasone	DMMWZET	Approved	Dexamethasone affects the expression of Myosin-6 (MYH6).	[42]
Folic acid	DMEMBJC	Approved	Folic acid decreases the expression of Myosin-6 (MYH6).	[43]
Rifampicin	DM5DSFZ	Approved	Rifampicin increases the expression of Myosin-6 (MYH6).	[44]
Mitoxantrone	DMM39BF	Approved	Mitoxantrone decreases the expression of Myosin-6 (MYH6).	[38]
Daunorubicin	DMQUSBT	Approved	Daunorubicin decreases the expression of Myosin-6 (MYH6).	[38]
Genistein	DM0JETC	Phase 2/3	Genistein decreases the expression of Myosin-6 (MYH6).	[39]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the mutagenesis of Myosin-6 (MYH6).	[45]
Ribavirin	DMEYLH9	Phase 1 Trial	Ribavirin decreases the expression of Myosin-6 (MYH6).	[46]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of Myosin-6 (MYH6).	[47]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Myosin-6 (MYH6).	[39]

References

• [1] Lentivirus-Mediated Knockdown of Myosin VI Inhibits Cell Proliferation of Breast Cancer Cell.Cancer Biother Radiopharm. 2015 Oct;30(8):330-5. doi: 10.1089/cbr.2014.1759. Epub 2015 Sep 25.
• [2] Sex Differences in Cardiac Mitochondria in the New Zealand Obese Mouse.Front Endocrinol (Lausanne). 2018 Dec 4;9:732. doi: 10.3389/fendo.2018.00732. eCollection 2018.
• [3] Competition between two high- and low-affinity protein-binding sites in myosin VI controls its cellular function.J Biol Chem. 2020 Jan 10;295(2):337-347. doi: 10.1074/jbc.RA119.010142. Epub 2019 Nov 19.
• [4] Filamin-A and Myosin VI colocalize with fibrillary Tau protein in Alzheimer's disease and FTDP-17 brains.Brain Res. 2010 Jul 23;1345:182-9. doi: 10.1016/j.brainres.2010.05.007. Epub 2010 May 10.
• [5] Biobank-driven genomic discovery yields new insight into atrial fibrillation biology.Nat Genet. 2018 Sep;50(9):1234-1239. doi: 10.1038/s41588-018-0171-3. Epub 2018 Jul 30.
• [6] Novel Genetic Variants of Sporadic Atrial Septal Defect (ASD) in a Chinese Population Identified by Whole-Exome Sequencing (WES).Med Sci Monit. 2018 Mar 5;24:1340-1358. doi: 10.12659/msm.908923.
• [7] Transcription Factor EB Activation Rescues Advanced B-Crystallin Mutation-Induced Cardiomyopathy by Normalizing Desmin Localization.J Am Heart Assoc. 2019 Feb 19;8(4):e010866. doi: 10.1161/JAHA.118.010866.
• [8] Downregulation of myosin VI reduced cell growth and increased apoptosis in human colorectal cancer.Acta Biochim Biophys Sin (Shanghai). 2016 May;48(5):430-6. doi: 10.1093/abbs/gmw020. Epub 2016 Apr 3.
• [9] Control of p21Cip by BRCA1-associated protein is critical for cardiomyocyte cell cycle progression and survival.Cardiovasc Res. 2020 Mar 1;116(3):592-604. doi: 10.1093/cvr/cvz177.
• [10] Genotype-phenotype relationship in three cases with overlapping 19p13.12 microdeletions.Eur J Hum Genet. 2010 Dec;18(12):1302-9. doi: 10.1038/ejhg.2010.115. Epub 2010 Jul 21.
• [11] Cardiac-Specific Cre Induces Age-Dependent Dilated Cardiomyopathy (DCM) in Mice.Molecules. 2019 Mar 26;24(6):1189. doi: 10.3390/molecules24061189.
• [12] Diverse functions of myosin VI elucidated by an isoform-specific -helix domain.Nat Struct Mol Biol. 2016 Apr;23(4):300-308. doi: 10.1038/nsmb.3187. Epub 2016 Mar 7.
• [13] Coding sequence rare variants identified in MYBPC3, MYH6, TPM1, TNNC1, and TNNI3 from 312 patients with familial or idiopathic dilated cardiomyopathy. Circ Cardiovasc Genet. 2010 Apr;3(2):155-61. doi: 10.1161/CIRCGENETICS.109.912345. Epub 2010 Mar 9.
• [14] Knockdown of Myosin VI Inhibits Proliferation of Hepatocellular Carcinoma Cells In Vitro.Chem Biol Drug Des. 2015 Oct;86(4):723-30. doi: 10.1111/cbdd.12544. Epub 2015 Mar 17.
• [15] Maternal diet-induced obesity programmes cardiac dysfunction in male mice independently of post-weaning diet.Cardiovasc Res. 2018 Aug 1;114(10):1372-1384. doi: 10.1093/cvr/cvy082.
• [16] Mutation in myosin heavy chain 6 causes atrial septal defect. Nat Genet. 2005 Apr;37(4):423-8. doi: 10.1038/ng1526. Epub 2005 Feb 27.
• [17] Impact of MYH6 variants in hypoplastic left heart syndrome.Physiol Genomics. 2016 Dec 1;48(12):912-921. doi: 10.1152/physiolgenomics.00091.2016. Epub 2016 Oct 27.
• [18] Changes in myosin and creatine kinase mRNA levels with cardiac hypertrophy and hypothyroidism.Basic Res Cardiol. 1990 Sep-Oct;85(5):481-94. doi: 10.1007/BF01931494.
• [19] Impact of cardiac-specific expression of CD39 on myocardial infarct size in mice.Life Sci. 2017 Jun 15;179:54-59. doi: 10.1016/j.lfs.2016.10.016. Epub 2016 Oct 15.
• [20] Myosin VI localization and expression in striated muscle pathology.Anat Rec (Hoboken). 2014 Sep;297(9):1706-13. doi: 10.1002/ar.22967.
• [21] Differential gene expression analysis of HNSCC tumors deciphered tobacco dependent and independent molecular signatures.Oncotarget. 2019 Oct 22;10(58):6168-6183. doi: 10.18632/oncotarget.27249. eCollection 2019 Oct 22.
• [22] A humanized mouse model, demonstrating progressive hearing loss caused by MYO6 p.C442Y, is inherited in a semi-dominant pattern.Hear Res. 2019 Aug;379:79-88. doi: 10.1016/j.heares.2019.04.014. Epub 2019 Apr 26.
• [23] Novel mutation in the -myosin heavy chain gene is associated with sick sinus syndrome.Circ Arrhythm Electrophysiol. 2015 Apr;8(2):400-8. doi: 10.1161/CIRCEP.114.002534. Epub 2015 Feb 25.
• [24] A rare variant in MYH6 is associated with high risk of sick sinus syndrome.Nat Genet. 2011 Mar 6;43(4):316-20. doi: 10.1038/ng.781.
• [25] An intermediate along the recovery stroke of myosin VI revealed by X-ray crystallography and molecular dynamics.Proc Natl Acad Sci U S A. 2018 Jun 12;115(24):6213-6218. doi: 10.1073/pnas.1711512115. Epub 2018 May 29.
• [26] Early remodeling of repolarizing K(+) currents in the MHC(403/+) mouse model of familial hypertrophic cardiomyopathy.J Mol Cell Cardiol. 2017 Feb;103:93-101. doi: 10.1016/j.yjmcc.2017.01.006. Epub 2017 Jan 13.
• [27] Spatial distribution of "tissue-specific" antigens in the developing human heart and skeletal muscle. II. An immunohistochemical analysis of myosin heavy chain isoform expression patterns in the embryonic heart. Anat Rec. 1991 Mar;229(3):355-68. doi: 10.1002/ar.1092290309.
• [28] Lentivirus-Mediated Silencing of Myosin VI Inhibits Proliferation and Cell Cycle Progression in Human Lung Cancer Cells.Chem Biol Drug Des. 2015 Oct;86(4):606-13. doi: 10.1111/cbdd.12528. Epub 2015 Feb 19.
• [29] Knockdown of myosin VI by lentivirus-mediated short hairpin RNA suppresses proliferation of melanoma.Mol Med Rep. 2015 Nov;12(5):6801-6. doi: 10.3892/mmr.2015.4261. Epub 2015 Aug 28.
• [30] Exome analysis of a family with Wolff-Parkinson-White syndrome identifies a novel disease locus.Am J Med Genet A. 2015 Dec;167A(12):2975-84. doi: 10.1002/ajmg.a.37297. Epub 2015 Aug 18.
• [31] Alpha-myosin heavy chain: a sarcomeric gene associated with dilated and hypertrophic phenotypes of cardiomyopathy. Circulation. 2005 Jul 5;112(1):54-9. doi: 10.1161/CIRCULATIONAHA.104.507699.
• [32] Defects in optineurin- and myosin VI-mediated cellular trafficking in amyotrophic lateral sclerosis.Hum Mol Genet. 2015 Jul 1;24(13):3830-46. doi: 10.1093/hmg/ddv126. Epub 2015 Apr 9.
• [33] CRISPR/Cas9 editing in human pluripotent stem cell-cardiomyocytes highlights arrhythmias, hypocontractility, and energy depletion as potential therapeutic targets for hypertrophic cardiomyopathy. Eur Heart J. 2018 Nov 14;39(43):3879-3892. doi: 10.1093/eurheartj/ehy249.
• [34] Technical standards for the interpretation and reporting of constitutional copy-number variants: a joint consensus recommendation of the American College of Medical Genetics and Genomics (ACMG) and the Clinical Genome Resource (ClinGen). Genet Med. 2020 Feb;22(2):245-257. doi: 10.1038/s41436-019-0686-8. Epub 2019 Nov 6.
• [35] Mutations in MYH7 reduce the force generating capacity of sarcomeres in human familial hypertrophic cardiomyopathy.Cardiovasc Res. 2013 Aug 1;99(3):432-41. doi: 10.1093/cvr/cvt119. Epub 2013 May 13.
• [36] NDP52 activates nuclear myosin VI to enhance RNA polymerase II transcription.Nat Commun. 2017 Nov 30;8(1):1871. doi: 10.1038/s41467-017-02050-w.
• [37] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [38] Identification of genomic biomarkers for anthracycline-induced cardiotoxicity in human iPSC-derived cardiomyocytes: an in vitro repeated exposure toxicity approach for safety assessment. Arch Toxicol. 2016 Nov;90(11):2763-2777.
• [39] Convergent transcriptional profiles induced by endogenous estrogen and distinct xenoestrogens in breast cancer cells. Carcinogenesis. 2006 Aug;27(8):1567-78.
• [40] Essential role of cell cycle regulatory genes p21 and p27 expression in inhibition of breast cancer cells by arsenic trioxide. Med Oncol. 2011 Dec;28(4):1225-54.
• [41] Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
• [42] Neuronal and cardiac toxicity of pharmacological compounds identified through transcriptomic analysis of human pluripotent stem cell-derived embryoid bodies. Toxicol Appl Pharmacol. 2021 Dec 15;433:115792. doi: 10.1016/j.taap.2021.115792. Epub 2021 Nov 3.
• [43] Folic acid supplementation dysregulates gene expression in lymphoblastoid cells--implications in nutrition. Biochem Biophys Res Commun. 2011 Sep 9;412(4):688-92. doi: 10.1016/j.bbrc.2011.08.027. Epub 2011 Aug 16.
• [44] Integrated analysis of rifampicin-induced microRNA and gene expression changes in human hepatocytes. Drug Metab Pharmacokinet. 2014;29(4):333-40.
• [45] Exome-wide mutation profile in benzo[a]pyrene-derived post-stasis and immortal human mammary epithelial cells. Mutat Res Genet Toxicol Environ Mutagen. 2014 Dec;775-776:48-54. doi: 10.1016/j.mrgentox.2014.10.011. Epub 2014 Nov 4.
• [46] Inhibition of cardiomyocyte differentiation of human induced pluripotent stem cells by Ribavirin: Implication for its cardiac developmental toxicity. Toxicology. 2020 Apr 15;435:152422. doi: 10.1016/j.tox.2020.152422. Epub 2020 Feb 26.
• [47] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [48] Association of the MYH6 Gene Polymorphism with the Risk of Atrial Fibrillation and Warfarin Anticoagulation Therapy. Genet Test Mol Biomarkers. 2021 Sep;25(9):590-599. doi: 10.1089/gtmb.2021.0025. Epub 2021 Sep 9.