Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT77SC9N)

• DOT Name: Far upstream element-binding protein 1 (FUBP1)
• Synonyms: FBP; FUSE-binding protein 1; DNA helicase V; hDH V
• Gene Name: FUBP1
• Related Disease:
  Acute myelogenous leukaemia
  Adenoma
  Advanced cancer
  Arthrogryposis
  Astrocytoma
  Breast cancer
  Breast carcinoma
  Chordoma
  Clear cell renal carcinoma
  Colitis
  Colorectal carcinoma
  Epithelial ovarian cancer
  Esophageal squamous cell carcinoma
  Ganglioneuroblastoma
  Glioma
  Hematologic disease
  Hemolytic anemia
  Hepatitis C virus infection
  Hepatocellular carcinoma
  leukaemia
  Leukemia
  Mantle cell lymphoma
  Maturity-onset diabetes of the young
  Myeloid leukaemia
  Myocardial infarction
  Neoplasm
  Neuroblastoma
  Non-insulin dependent diabetes
  Schizophrenia
  Sciatic neuropathy
  Carcinoma of liver and intrahepatic biliary tract
  Gastric cancer
  Liver cancer
  Pancreatic cancer
  Stomach cancer
  Parkinson disease
  Rett syndrome
• UniProt ID: FUBP1_HUMAN
• PDB ID: 1J4W; 2KXH; 4LIJ; 6Y24; 6Y2C; 6Y2D; 8P25
• Pfam ID: PF09005 ; PF00013
• Sequence:
  MADYSTVPPPSSGSAGGGGGGGGGGGVNDAFKDALQRARQIAAKIGGDAGTSLNSNDYGY
  GGQKRPLEDGDQPDAKKVAPQNDSFGTQLPPMHQQQSRSVMTEEYKVPDGMVGFIIGRGG
  EQISRIQQESGCKIQIAPDSGGLPERSCMLTGTPESVQSAKRLLDQIVEKGRPAPGFHHG
  DGPGNAVQEIMIPASKAGLVIGKGGETIKQLQERAGVKMVMIQDGPQNTGADKPLRITGD
  PYKVQQAKEMVLELIRDQGGFREVRNEYGSRIGGNEGIDVPIPRFAVGIVIGRNGEMIKK
  IQNDAGVRIQFKPDDGTTPERIAQITGPPDRCQHAAEIITDLLRSVQAGNPGGPGPGGRG
  RGRGQGNWNMGPPGGLQEFNFIVPTGKTGLIIGKGGETIKSISQQSGARIELQRNPPPNA
  DPNMKLFTIRGTPQQIDYARQLIEEKIGGPVNPLGPPVPHGPHGVPGPHGPPGPPGPGTP
  MGPYNPAPYNPGPPGPAPHGPPAPYAPQGWGNAYPHWQQQAPPDPAKAGTDPNSAAWAAY
  YAHYYQQQAQPPPAAPAGAPTTTQTNGQGDQQNPAPAGQVDYTKAWEEYYKKMGQAVPAP
  TGAPPGGQPDYSAAWAEYYRQQAAYYAQTSPQGMPQHPPAPQGQ
• Function: Regulates MYC expression by binding to a single-stranded far-upstream element (FUSE) upstream of the MYC promoter. May act both as activator and repressor of transcription.

Molecular Interaction Atlas (MIA) of This DOT

37 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Acute myelogenous leukaemia	DISCSPTN	Strong	Biomarker	[1]
Adenoma	DIS78ZEV	Strong	Biomarker	[2]
Advanced cancer	DISAT1Z9	Strong	Altered Expression	[3]
Arthrogryposis	DISC81CM	Strong	Genetic Variation	[4]
Astrocytoma	DISL3V18	Strong	Genetic Variation	[5]
Breast cancer	DIS7DPX1	Strong	Altered Expression	[6]
Breast carcinoma	DIS2UE88	Strong	Altered Expression	[6]
Chordoma	DISCHJE7	Strong	Altered Expression	[7]
Clear cell renal carcinoma	DISBXRFJ	Strong	Altered Expression	[8]
Colitis	DISAF7DD	Strong	Biomarker	[9]
Colorectal carcinoma	DIS5PYL0	Strong	Altered Expression	[10]
Epithelial ovarian cancer	DIS56MH2	Strong	Biomarker	[11]
Esophageal squamous cell carcinoma	DIS5N2GV	Strong	Altered Expression	[12]
Ganglioneuroblastoma	DIS6FPB6	Strong	Altered Expression	[13]
Glioma	DIS5RPEH	Strong	Altered Expression	[14]
Hematologic disease	DIS9XD9A	Strong	Biomarker	[3]
Hemolytic anemia	DIS803XQ	Strong	Genetic Variation	[4]
Hepatitis C virus infection	DISQ0M8R	Strong	Biomarker	[15]
Hepatocellular carcinoma	DIS0J828	Strong	Biomarker	[16]
leukaemia	DISS7D1V	Strong	Biomarker	[17]
Leukemia	DISNAKFL	Strong	Biomarker	[17]
Mantle cell lymphoma	DISFREOV	Strong	Genetic Variation	[18]
Maturity-onset diabetes of the young	DISG75M5	Strong	Biomarker	[19]
Myeloid leukaemia	DISMN944	Strong	Biomarker	[17]
Myocardial infarction	DIS655KI	Strong	Genetic Variation	[20]
Neoplasm	DISZKGEW	Strong	Altered Expression	[21]
Neuroblastoma	DISVZBI4	Strong	Biomarker	[13]
Non-insulin dependent diabetes	DISK1O5Z	Strong	Biomarker	[19]
Schizophrenia	DISSRV2N	Strong	Altered Expression	[22]
Sciatic neuropathy	DISMGDKX	Strong	Biomarker	[23]
Carcinoma of liver and intrahepatic biliary tract	DIS8WA0W	moderate	Biomarker	[16]
Gastric cancer	DISXGOUK	moderate	Biomarker	[24]
Liver cancer	DISDE4BI	moderate	Biomarker	[16]
Pancreatic cancer	DISJC981	moderate	Altered Expression	[25]
Stomach cancer	DISKIJSX	moderate	Biomarker	[24]
Parkinson disease	DISQVHKL	Limited	Biomarker	[26]
Rett syndrome	DISGG5UV	Limited	Biomarker	[27]

19 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Far upstream element-binding protein 1 (FUBP1).	[28]
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Far upstream element-binding protein 1 (FUBP1).	[29]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Far upstream element-binding protein 1 (FUBP1).	[30]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Far upstream element-binding protein 1 (FUBP1).	[31]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Far upstream element-binding protein 1 (FUBP1).	[32]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Far upstream element-binding protein 1 (FUBP1).	[33]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide decreases the expression of Far upstream element-binding protein 1 (FUBP1).	[35]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of Far upstream element-binding protein 1 (FUBP1).	[36]
Clozapine	DMFC71L	Approved	Clozapine increases the expression of Far upstream element-binding protein 1 (FUBP1).	[37]
Amphotericin B	DMTAJQE	Approved	Amphotericin B decreases the expression of Far upstream element-binding protein 1 (FUBP1).	[38]
Leflunomide	DMR8ONJ	Phase 1 Trial	Leflunomide decreases the expression of Far upstream element-binding protein 1 (FUBP1).	[39]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Far upstream element-binding protein 1 (FUBP1).	[41]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Far upstream element-binding protein 1 (FUBP1).	[43]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A decreases the expression of Far upstream element-binding protein 1 (FUBP1).	[44]
Milchsaure	DM462BT	Investigative	Milchsaure increases the expression of Far upstream element-binding protein 1 (FUBP1).	[45]
3R14S-OCHRATOXIN A	DM2KEW6	Investigative	3R14S-OCHRATOXIN A decreases the expression of Far upstream element-binding protein 1 (FUBP1).	[46]
geraniol	DMS3CBD	Investigative	geraniol decreases the expression of Far upstream element-binding protein 1 (FUBP1).	[48]
4-hydroxy-2-nonenal	DM2LJFZ	Investigative	4-hydroxy-2-nonenal decreases the expression of Far upstream element-binding protein 1 (FUBP1).	[49]
Butanoic acid	DMTAJP7	Investigative	Butanoic acid increases the expression of Far upstream element-binding protein 1 (FUBP1).	[50]

5 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Arsenic	DMTL2Y1	Approved	Arsenic affects the methylation of Far upstream element-binding protein 1 (FUBP1).	[34]
TAK-243	DM4GKV2	Phase 1	TAK-243 decreases the sumoylation of Far upstream element-binding protein 1 (FUBP1).	[40]
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 affects the phosphorylation of Far upstream element-binding protein 1 (FUBP1).	[42]
Coumarin	DM0N8ZM	Investigative	Coumarin increases the phosphorylation of Far upstream element-binding protein 1 (FUBP1).	[42]
Hexadecanoic acid	DMWUXDZ	Investigative	Hexadecanoic acid decreases the phosphorylation of Far upstream element-binding protein 1 (FUBP1).	[47]

References

• [1] Association of Leukemia Target Genes Tet2, Bcl2, and Slc23a2 in Vitamin C Pathways.Cancer Genomics Proteomics. 2019 Sep-Oct;16(5):333-344. doi: 10.21873/cgp.20138.
• [2] Far upstream element-binding protein 1(FUBP1) expression differs between human colorectal cancer and non-cancerous tissue.Neoplasma. 2014;61(5):533-40. doi: 10.4149/neo_2014_065.
• [3] The master regulator FUBP1: its emerging role in normal cell function and malignant development.Cell Mol Life Sci. 2019 Jan;76(2):259-281. doi: 10.1007/s00018-018-2933-6. Epub 2018 Oct 20.
• [4] Human aldolase A natural mutants: relationship between flexibility of the C-terminal region and enzyme function.Biochem J. 2004 May 15;380(Pt 1):51-6. doi: 10.1042/BJ20031941.
• [5] Frequent ATRX, CIC, FUBP1 and IDH1 mutations refine the classification of malignant gliomas.Oncotarget. 2012 Jul;3(7):709-22. doi: 10.18632/oncotarget.588.
• [6] MiR-16 mediates trastuzumab and lapatinib response in ErbB-2-positive breast and gastric cancer via its novel targets CCNJ and FUBP1.Oncogene. 2016 Dec 1;35(48):6189-6202. doi: 10.1038/onc.2016.151. Epub 2016 May 9.
• [7] Expression of far upstream element-binding protein 1 correlates with c-Myc expression in sacral chordomas and is associated with tumor progression and poor prognosis.Biochem Biophys Res Commun. 2017 Sep 30;491(4):1047-1054. doi: 10.1016/j.bbrc.2017.08.008. Epub 2017 Aug 3.
• [8] Upregulation of Far Upstream Element-Binding Protein 1 (FUBP1) Promotes Tumor Proliferation and Tumorigenesis of Clear Cell Renal Cell Carcinoma.PLoS One. 2017 Jan 11;12(1):e0169852. doi: 10.1371/journal.pone.0169852. eCollection 2017.
• [9] Role of far upstream element binding protein 1 in colonic epithelial disruption during dextran sulphate sodium-induced murine colitis.Int J Clin Exp Pathol. 2014 Apr 15;7(5):2019-31. eCollection 2014.
• [10] Camptothecin and its analog SN-38, the active metabolite of irinotecan, inhibit binding of the transcriptional regulator and oncoprotein FUBP1 to its DNA target sequence FUSE.Biochem Pharmacol. 2017 Dec 15;146:53-62. doi: 10.1016/j.bcp.2017.10.003. Epub 2017 Oct 13.
• [11] Knockdown of FUSE binding protein 1 enhances the sensitivity of epithelial ovarian cancer cells to carboplatin.Oncol Lett. 2017 Nov;14(5):5819-5824. doi: 10.3892/ol.2017.6978. Epub 2017 Sep 15.
• [12] Far upstream element-binding protein 1 (FUBP1) is a potential c-Myc regulator in esophageal squamous cell carcinoma (ESCC) and its expression promotes ESCC progression.Tumour Biol. 2016 Mar;37(3):4115-26. doi: 10.1007/s13277-015-4263-8. Epub 2015 Oct 21.
• [13] FUBP1 promotes neuroblastoma proliferation via enhancing glycolysis-a new possible marker of malignancy for neuroblastoma.J Exp Clin Cancer Res. 2019 Sep 11;38(1):400. doi: 10.1186/s13046-019-1414-6.
• [14] Loss of FUBP1 expression in gliomas predicts FUBP1 mutation and is associated with oligodendroglial differentiation, IDH1 mutation and 1p/19q loss of heterozygosity.Neuropathol Appl Neurobiol. 2014 Feb;40(2):205-16. doi: 10.1111/nan.12088.
• [15] FUSE Binding Protein 1 Facilitates Persistent Hepatitis C Virus Replication in Hepatoma Cells by Regulating Tumor Suppressor p53.J Virol. 2015 Aug;89(15):7905-21. doi: 10.1128/JVI.00729-15. Epub 2015 May 20.
• [16] Far upstream element-binding protein 1 facilitates hepatocellular carcinoma invasion and metastasis.Carcinogenesis. 2020 Jul 14;41(7):950-960. doi: 10.1093/carcin/bgz171.
• [17] The transcriptional regulator FUBP1 influences disease outcome in murine and human myeloid leukemia.Leukemia. 2019 Jul;33(7):1700-1712. doi: 10.1038/s41375-018-0358-8. Epub 2019 Jan 11.
• [18] Mantle cell lymphoma-variant Richter syndrome: Detailed molecular-cytogenetic and backtracking analysis reveals slow evolution of a pre-MCL clone in parallel with CLL over several years.Int J Cancer. 2016 Nov 15;139(10):2252-60. doi: 10.1002/ijc.30263. Epub 2016 Aug 2.
• [19] Fructose-1,6-bisphosphatase: genetic and physical mapping to human chromosome 9q22.3 and evaluation in non-insulin-dependent diabetes mellitus.Genomics. 1995 Sep 1;29(1):187-94. doi: 10.1006/geno.1995.1230.
• [20] Lipid-associated genetic polymorphisms are associated with FBP and LDL-c levels among myocardial infarction patients in Chinese population.Gene. 2018 Nov 15;676:22-28. doi: 10.1016/j.gene.2018.07.016. Epub 2018 Jul 10.
• [21] PUF60 accelerates the progression of breast cancer through downregulation of PTEN expression.Cancer Manag Res. 2019 Jan 17;11:821-830. doi: 10.2147/CMAR.S180242. eCollection 2019.
• [22] Prefrontal cortex shotgun proteome analysis reveals altered calcium homeostasis and immune system imbalance in schizophrenia.Eur Arch Psychiatry Clin Neurosci. 2009 Apr;259(3):151-63. doi: 10.1007/s00406-008-0847-2. Epub 2009 Jan 22.
• [23] FBP1 and p27kip1 expression after sciatic nerve injury: implications for Schwann cells proliferation and differentiation.J Cell Biochem. 2014 Jan;115(1):130-40. doi: 10.1002/jcb.24640.
• [24] MiR-16-1 Targeted Silences Far Upstream Element Binding Protein 1 to Advance the Chemosensitivity to Adriamycin in Gastric Cancer.Pathol Oncol Res. 2018 Jul;24(3):483-488. doi: 10.1007/s12253-017-0263-x. Epub 2017 Jun 30.
• [25] Far upstream element-binding protein 1 is up-regulated in pancreatic cancer and modulates immune response by increasing programmed death ligand 1.Biochem Biophys Res Commun. 2018 Nov 2;505(3):830-836. doi: 10.1016/j.bbrc.2018.10.009. Epub 2018 Oct 6.
• [26] Identification of far upstream element-binding protein-1 as an authentic Parkin substrate.J Biol Chem. 2006 Jun 16;281(24):16193-6. doi: 10.1074/jbc.C600041200. Epub 2006 May 3.
• [27] Reduced folate transport to the CNS in female Rett patients.Neurology. 2003 Aug 26;61(4):506-15. doi: 10.1212/01.wnl.0000078939.64774.1b.
• [28] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [29] Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
• [30] Retinoic acid-induced downmodulation of telomerase activity in human cancer cells. Exp Mol Pathol. 2005 Oct;79(2):108-17.
• [31] Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
• [32] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [33] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [34] Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
• [35] Proteomic and functional analyses reveal a dual molecular mechanism underlying arsenic-induced apoptosis in human multiple myeloma cells. J Proteome Res. 2009 Jun;8(6):3006-19.
• [36] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [37] Cannabidiol Displays Proteomic Similarities to Antipsychotics in Cuprizone-Exposed Human Oligodendrocytic Cell Line MO3.13. Front Mol Neurosci. 2021 May 28;14:673144. doi: 10.3389/fnmol.2021.673144. eCollection 2021.
• [38] Differential expression of microRNAs and their predicted targets in renal cells exposed to amphotericin B and its complex with copper (II) ions. Toxicol Mech Methods. 2017 Sep;27(7):537-543. doi: 10.1080/15376516.2017.1333554. Epub 2017 Jun 8.
• [39] Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
• [40] Inhibiting ubiquitination causes an accumulation of SUMOylated newly synthesized nuclear proteins at PML bodies. J Biol Chem. 2019 Oct 18;294(42):15218-15234. doi: 10.1074/jbc.RA119.009147. Epub 2019 Jul 8.
• [41] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [42] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [43] Epigenetic influences of low-dose bisphenol A in primary human breast epithelial cells. Toxicol Appl Pharmacol. 2010 Oct 15;248(2):111-21.
• [44] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [45] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
• [46] Lipid Rafts Disruption Increases Ochratoxin A Cytotoxicity to Hepatocytes. J Biochem Mol Toxicol. 2016 Feb;30(2):71-9. doi: 10.1002/jbt.21738. Epub 2015 Aug 25.
• [47] Functional lipidomics: Palmitic acid impairs hepatocellular carcinoma development by modulating membrane fluidity and glucose metabolism. Hepatology. 2017 Aug;66(2):432-448. doi: 10.1002/hep.29033. Epub 2017 Jun 16.
• [48] Geraniol suppresses prostate cancer growth through down-regulation of E2F8. Cancer Med. 2016 Oct;5(10):2899-2908.
• [49] Microarray analysis of H2O2-, HNE-, or tBH-treated ARPE-19 cells. Free Radic Biol Med. 2002 Nov 15;33(10):1419-32.
• [50] MS4A3-HSP27 target pathway reveals potential for haematopoietic disorder treatment in alimentary toxic aleukia. Cell Biol Toxicol. 2023 Feb;39(1):201-216. doi: 10.1007/s10565-021-09639-4. Epub 2021 Sep 28.