Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT85HIJ5)

• DOT Name: Nucleolar and spindle-associated protein 1 (NUSAP1)
• Synonyms: NuSAP
• Gene Name: NUSAP1
• Related Disease:
  Colorectal neoplasm
  Advanced cancer
  Astrocytoma
  Breast cancer
  Breast carcinoma
  Carcinoma of liver and intrahepatic biliary tract
  Cervical cancer
  Cervical carcinoma
  Clear cell renal carcinoma
  Colon cancer
  Colon carcinoma
  Colonic neoplasm
  Colorectal carcinoma
  Esophageal squamous cell carcinoma
  Gastric cancer
  Glioblastoma multiforme
  Glioma
  Inflammatory breast cancer
  Invasive breast carcinoma
  Liver cancer
  Lung cancer
  Lung carcinoma
  Metabolic disorder
  Non-small-cell lung cancer
  Prostate cancer
  Prostate carcinoma
  Renal cell carcinoma
  Stomach cancer
  Squamous cell carcinoma
  Triple negative breast cancer
  Adult glioblastoma
  Ebola virus infection
  Hepatocellular carcinoma
• UniProt ID: NUSAP_HUMAN
• Pfam ID: PF16006
• Sequence:
  MIIPSLEELDSLKYSDLQNLAKSLGLRANLRATKLLKALKGYIKHEARKGNENQDESQTS
  ASSCDETEIQISNQEEAERQPLGHVTKTRRRCKTVRVDPDSQQNHSEIKISNPTEFQNHE
  KQESQDLRATAKVPSPPDEHQEAENAVSSGNRDSKVPSEGKKSLYTDESSKPGKNKRTAI
  TTPNFKKLHEAHFKEMESIDQYIERKKKHFEEHNSMNELKQQPINKGGVRTPVPPRGRLS
  VASTPISQRRSQGRSCGPASQSTLGLKGSLKRSAISAAKTGVRFSAATKDNEHKRSLTKT
  PARKSAHVTVSGGTPKGEAVLGTHKLKTITGNSAAVITPFKLTTEATQTPVSNKKPVFDL
  KASLSRPLNYEPHKGKLKPWGQSKENNYLNQHVNRINFYKKTYKQPHLQTKEEQRKKREQ
  ERKEKKAKVLGMRRGLILAED
• Function: Microtubule-associated protein with the capacity to bundle and stabilize microtubules. May associate with chromosomes and promote the organization of mitotic spindle microtubules around them.

Molecular Interaction Atlas (MIA) of This DOT

33 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Colorectal neoplasm	DISR1UCN	Definitive	Biomarker	[1]
Advanced cancer	DISAT1Z9	Strong	Biomarker	[2]
Astrocytoma	DISL3V18	Strong	Altered Expression	[3]
Breast cancer	DIS7DPX1	Strong	Biomarker	[4]
Breast carcinoma	DIS2UE88	Strong	Biomarker	[4]
Carcinoma of liver and intrahepatic biliary tract	DIS8WA0W	Strong	Altered Expression	[5]
Cervical cancer	DISFSHPF	Strong	Biomarker	[2]
Cervical carcinoma	DIST4S00	Strong	Biomarker	[2]
Clear cell renal carcinoma	DISBXRFJ	Strong	Biomarker	[6]
Colon cancer	DISVC52G	Strong	Biomarker	[7]
Colon carcinoma	DISJYKUO	Strong	Biomarker	[7]
Colonic neoplasm	DISSZ04P	Strong	Altered Expression	[7]
Colorectal carcinoma	DIS5PYL0	Strong	Biomarker	[8]
Esophageal squamous cell carcinoma	DIS5N2GV	Strong	Altered Expression	[9]
Gastric cancer	DISXGOUK	Strong	Altered Expression	[10]
Glioblastoma multiforme	DISK8246	Strong	Altered Expression	[11]
Glioma	DIS5RPEH	Strong	Altered Expression	[12]
Inflammatory breast cancer	DIS3QRWA	Strong	Altered Expression	[13]
Invasive breast carcinoma	DISANYTW	Strong	Biomarker	[13]
Liver cancer	DISDE4BI	Strong	Altered Expression	[5]
Lung cancer	DISCM4YA	Strong	Biomarker	[14]
Lung carcinoma	DISTR26C	Strong	Biomarker	[14]
Metabolic disorder	DIS71G5H	Strong	Biomarker	[15]
Non-small-cell lung cancer	DIS5Y6R9	Strong	Biomarker	[16]
Prostate cancer	DISF190Y	Strong	Biomarker	[17]
Prostate carcinoma	DISMJPLE	Strong	Biomarker	[17]
Renal cell carcinoma	DISQZ2X8	Strong	Biomarker	[6]
Stomach cancer	DISKIJSX	Strong	Altered Expression	[10]
Squamous cell carcinoma	DISQVIFL	moderate	Altered Expression	[18]
Triple negative breast cancer	DISAMG6N	moderate	Biomarker	[19]
Adult glioblastoma	DISVP4LU	Limited	Altered Expression	[11]
Ebola virus infection	DISJAVM1	Limited	Biomarker	[20]
Hepatocellular carcinoma	DIS0J828	Limited	Biomarker	[21]

This DOT Affected the Drug Response of 2 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Paclitaxel	DMLB81S	Approved	Nucleolar and spindle-associated protein 1 (NUSAP1) affects the response to substance of Paclitaxel.	[52]
Vinblastine	DM5TVS3	Approved	Nucleolar and spindle-associated protein 1 (NUSAP1) affects the response to substance of Vinblastine.	[52]

31 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Nucleolar and spindle-associated protein 1 (NUSAP1).	[22]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Nucleolar and spindle-associated protein 1 (NUSAP1).	[23]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Nucleolar and spindle-associated protein 1 (NUSAP1).	[24]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Nucleolar and spindle-associated protein 1 (NUSAP1).	[25]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Nucleolar and spindle-associated protein 1 (NUSAP1).	[26]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Nucleolar and spindle-associated protein 1 (NUSAP1).	[27]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Nucleolar and spindle-associated protein 1 (NUSAP1).	[28]
Quercetin	DM3NC4M	Approved	Quercetin decreases the expression of Nucleolar and spindle-associated protein 1 (NUSAP1).	[29]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide increases the expression of Nucleolar and spindle-associated protein 1 (NUSAP1).	[30]
Calcitriol	DM8ZVJ7	Approved	Calcitriol decreases the expression of Nucleolar and spindle-associated protein 1 (NUSAP1).	[31]
Testosterone	DM7HUNW	Approved	Testosterone decreases the expression of Nucleolar and spindle-associated protein 1 (NUSAP1).	[31]
Methotrexate	DM2TEOL	Approved	Methotrexate decreases the expression of Nucleolar and spindle-associated protein 1 (NUSAP1).	[32]
Marinol	DM70IK5	Approved	Marinol decreases the expression of Nucleolar and spindle-associated protein 1 (NUSAP1).	[33]
Progesterone	DMUY35B	Approved	Progesterone decreases the expression of Nucleolar and spindle-associated protein 1 (NUSAP1).	[34]
Demecolcine	DMCZQGK	Approved	Demecolcine decreases the expression of Nucleolar and spindle-associated protein 1 (NUSAP1).	[35]
Troglitazone	DM3VFPD	Approved	Troglitazone decreases the expression of Nucleolar and spindle-associated protein 1 (NUSAP1).	[36]
Azathioprine	DMMZSXQ	Approved	Azathioprine decreases the expression of Nucleolar and spindle-associated protein 1 (NUSAP1).	[37]
Irinotecan	DMP6SC2	Approved	Irinotecan decreases the expression of Nucleolar and spindle-associated protein 1 (NUSAP1).	[38]
Dasatinib	DMJV2EK	Approved	Dasatinib decreases the expression of Nucleolar and spindle-associated protein 1 (NUSAP1).	[39]
Lucanthone	DMZLBUO	Approved	Lucanthone decreases the expression of Nucleolar and spindle-associated protein 1 (NUSAP1).	[40]
Palbociclib	DMD7L94	Approved	Palbociclib decreases the expression of Nucleolar and spindle-associated protein 1 (NUSAP1).	[41]
Bicalutamide	DMZMSPF	Approved	Bicalutamide decreases the expression of Nucleolar and spindle-associated protein 1 (NUSAP1).	[42]
Urethane	DM7NSI0	Phase 4	Urethane increases the expression of Nucleolar and spindle-associated protein 1 (NUSAP1).	[43]
phorbol 12-myristate 13-acetate	DMJWD62	Phase 2	phorbol 12-myristate 13-acetate increases the expression of Nucleolar and spindle-associated protein 1 (NUSAP1).	[44]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of Nucleolar and spindle-associated protein 1 (NUSAP1).	[29]
Leflunomide	DMR8ONJ	Phase 1 Trial	Leflunomide decreases the expression of Nucleolar and spindle-associated protein 1 (NUSAP1).	[45]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Nucleolar and spindle-associated protein 1 (NUSAP1).	[46]
THAPSIGARGIN	DMDMQIE	Preclinical	THAPSIGARGIN decreases the expression of Nucleolar and spindle-associated protein 1 (NUSAP1).	[48]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Nucleolar and spindle-associated protein 1 (NUSAP1).	[49]
Coumestrol	DM40TBU	Investigative	Coumestrol increases the expression of Nucleolar and spindle-associated protein 1 (NUSAP1).	[50]
geraniol	DMS3CBD	Investigative	geraniol decreases the expression of Nucleolar and spindle-associated protein 1 (NUSAP1).	[51]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 increases the phosphorylation of Nucleolar and spindle-associated protein 1 (NUSAP1).	[47]

References

• [1] Highly Expressed Genes in Rapidly Proliferating Tumor Cells as New Targets for Colorectal Cancer Treatment.Clin Cancer Res. 2015 Aug 15;21(16):3695-704. doi: 10.1158/1078-0432.CCR-14-2457. Epub 2015 May 5.
• [2] Nucleolar and spindle associated protein 1 promotes metastasis of cervical carcinoma cells by activating Wnt/-catenin signaling.J Exp Clin Cancer Res. 2019 Jan 24;38(1):33. doi: 10.1186/s13046-019-1037-y.
• [3] Nucleolar and spindle associated protein 1 promotes the aggressiveness of astrocytoma by activating the Hedgehog signaling pathway.J Exp Clin Cancer Res. 2017 Sep 12;36(1):127. doi: 10.1186/s13046-017-0597-y.
• [4] A four-gene signature for prognosis in breast cancer patients with hypermethylated IL15RA.Oncol Lett. 2019 May;17(5):4245-4254. doi: 10.3892/ol.2019.10137. Epub 2019 Mar 12.
• [5] Downregulation of nucleolar and spindle-associated protein 1 expression suppresses liver cancer cell function.Exp Ther Med. 2019 Apr;17(4):2969-2978. doi: 10.3892/etm.2019.7314. Epub 2019 Feb 26.
• [6] Downregulation of nucleolar and spindle-associated protein1 expression suppresses cell migration, proliferation and invasion in renal cell carcinoma.Oncol Rep. 2016 Sep;36(3):1506-16. doi: 10.3892/or.2016.4955. Epub 2016 Jul 20.
• [7] High NUSAP1 expression predicts poor prognosis in colon cancer.Pathol Res Pract. 2018 Jul;214(7):968-973. doi: 10.1016/j.prp.2018.05.017. Epub 2018 May 22.
• [8] NUSAP1 gene silencing inhibits cell proliferation, migration and invasion through inhibiting DNMT1 gene expression in human colorectal cancer.Exp Cell Res. 2018 Jun 15;367(2):216-221. doi: 10.1016/j.yexcr.2018.03.039. Epub 2018 Mar 30.
• [9] Nucleolar spindle-associated protein 1 promotes tumorigenesis and predicts poor prognosis in human esophageal squamous cell carcinoma.J Cell Biochem. 2019 Jul;120(7):11726-11737. doi: 10.1002/jcb.28452. Epub 2019 Feb 21.
• [10] Downregulation of NUSAP1 suppresses cell proliferation, migration, and invasion via inhibiting mTORC1 signalling pathway in gastric cancer.Cell Biochem Funct. 2020 Jan;38(1):28-37. doi: 10.1002/cbf.3444. Epub 2019 Nov 11.
• [11] Identification of Driver Genes and Key Pathways of Glioblastoma Shows JNJ-7706621 as a Novel Antiglioblastoma Drug.World Neurosurg. 2018 Jan;109:e329-e342. doi: 10.1016/j.wneu.2017.09.176. Epub 2017 Oct 6.
• [12] Nucleolar and spindle-associated protein 1 is a tumor grade correlated prognosis marker for glioma patients.CNS Neurosci Ther. 2018 Mar;24(3):178-186. doi: 10.1111/cns.12803. Epub 2018 Jan 15.
• [13] Nucleolar and Spindle Associated Protein 1 (NUSAP1) Inhibits Cell Proliferation and Enhances Susceptibility to Epirubicin In Invasive Breast Cancer Cells by Regulating Cyclin D Kinase (CDK1) and DLGAP5 Expression.Med Sci Monit. 2018 Nov 26;24:8553-8564. doi: 10.12659/MSM.910364.
• [14] Screening of tumor-associated antigens based on Oncomine database and evaluation of diagnostic value of autoantibodies in lung cancer.Clin Immunol. 2020 Jan;210:108262. doi: 10.1016/j.clim.2019.108262. Epub 2019 Oct 17.
• [15] Effects of imidazoline-like drugs on liver and adipose tissues, and their role in preventing obesity and associated cardio-metabolic disorders.Int J Obes (Lond). 2019 Nov;43(11):2163-2175. doi: 10.1038/s41366-019-0342-z. Epub 2019 Mar 29.
• [16] NUSAP1 knockdown inhibits cell growth and metastasis of non-small-cell lung cancer through regulating BTG2/PI3K/Akt signaling.J Cell Physiol. 2020 Apr;235(4):3886-3893. doi: 10.1002/jcp.29282. Epub 2019 Oct 11.
• [17] SWATH proteomic profiling of prostate cancer cells identifies NUSAP1 as a potential molecular target for Galiellalactone.J Proteomics. 2019 Feb 20;193:217-229. doi: 10.1016/j.jprot.2018.10.012. Epub 2018 Oct 25.
• [18] Down-Regulation of Nucleolar and Spindle-Associated Protein 1 (NUSAP1) Expression Suppresses Tumor and Cell Proliferation and Enhances Anti-Tumor Effect of Paclitaxel in Oral Squamous Cell Carcinoma.PLoS One. 2015 Nov 10;10(11):e0142252. doi: 10.1371/journal.pone.0142252. eCollection 2015.
• [19] Systemic Administration of siRNA with Anti-HB-EGF Antibody-Modified Lipid Nanoparticles for the Treatment of Triple-Negative Breast Cancer.Mol Pharm. 2018 Apr 2;15(4):1495-1504. doi: 10.1021/acs.molpharmaceut.7b01055. Epub 2018 Mar 12.
• [20] Emerging targets and novel approaches to Ebola virus prophylaxis and treatment.BioDrugs. 2013 Dec;27(6):565-83. doi: 10.1007/s40259-013-0046-1.
• [21] Transcriptome Analysis Revealed a Highly Connected Gene Module Associated With Cirrhosis to Hepatocellular Carcinoma Development.Front Genet. 2019 Apr 2;10:305. doi: 10.3389/fgene.2019.00305. eCollection 2019.
• [22] Stem cell transcriptome responses and corresponding biomarkers that indicate the transition from adaptive responses to cytotoxicity. Chem Res Toxicol. 2017 Apr 17;30(4):905-922.
• [23] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [24] Effect of retinoic acid on gene expression in human conjunctival epithelium: secretory phospholipase A2 mediates retinoic acid induction of MUC16. Invest Ophthalmol Vis Sci. 2005 Nov;46(11):4050-61.
• [25] Predictive toxicology using systemic biology and liver microfluidic "on chip" approaches: application to acetaminophen injury. Toxicol Appl Pharmacol. 2012 Mar 15;259(3):270-80.
• [26] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [27] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [28] Genistein and bisphenol A exposure cause estrogen receptor 1 to bind thousands of sites in a cell type-specific manner. Genome Res. 2012 Nov;22(11):2153-62.
• [29] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [30] Essential role of cell cycle regulatory genes p21 and p27 expression in inhibition of breast cancer cells by arsenic trioxide. Med Oncol. 2011 Dec;28(4):1225-54.
• [31] Effects of 1alpha,25 dihydroxyvitamin D3 and testosterone on miRNA and mRNA expression in LNCaP cells. Mol Cancer. 2011 May 18;10:58.
• [32] Methotrexate modulates folate phenotype and inflammatory profile in EA.hy 926 cells. Eur J Pharmacol. 2014 Jun 5;732:60-7.
• [33] JunD is involved in the antiproliferative effect of Delta9-tetrahydrocannabinol on human breast cancer cells. Oncogene. 2008 Aug 28;27(37):5033-44.
• [34] Effects of progesterone treatment on expression of genes involved in uterine quiescence. Reprod Sci. 2011 Aug;18(8):781-97.
• [35] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
• [36] Effects of ciglitazone and troglitazone on the proliferation of human stomach cancer cells. World J Gastroenterol. 2009 Jan 21;15(3):310-20.
• [37] A transcriptomics-based in vitro assay for predicting chemical genotoxicity in vivo. Carcinogenesis. 2012 Jul;33(7):1421-9.
• [38] Clinical determinants of response to irinotecan-based therapy derived from cell line models. Clin Cancer Res. 2008 Oct 15;14(20):6647-55.
• [39] Dasatinib reverses cancer-associated fibroblasts (CAFs) from primary lung carcinomas to a phenotype comparable to that of normal fibroblasts. Mol Cancer. 2010 Jun 27;9:168.
• [40] Lucanthone is a novel inhibitor of autophagy that induces cathepsin D-mediated apoptosis. J Biol Chem. 2011 Feb 25;286(8):6602-13.
• [41] Cdk4/6 inhibition induces epithelial-mesenchymal transition and enhances invasiveness in pancreatic cancer cells. Mol Cancer Ther. 2012 Oct;11(10):2138-48. doi: 10.1158/1535-7163.MCT-12-0562. Epub 2012 Aug 6.
• [42] Microarray analysis of bicalutamide action on telomerase activity, p53 pathway and viability of prostate carcinoma cell lines. J Pharm Pharmacol. 2005 Jan;57(1):83-92.
• [43] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [44] Comparison of gene expression profiles in HepG2 cells exposed to arsenic, cadmium, nickel, and three model carcinogens for investigating the mechanisms of metal carcinogenesis. Environ Mol Mutagen. 2009 Jan;50(1):46-59.
• [45] Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
• [46] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [47] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [48] Endoplasmic reticulum stress impairs insulin signaling through mitochondrial damage in SH-SY5Y cells. Neurosignals. 2012;20(4):265-80.
• [49] Bisphenol A induces DSB-ATM-p53 signaling leading to cell cycle arrest, senescence, autophagy, stress response, and estrogen release in human fetal lung fibroblasts. Arch Toxicol. 2018 Apr;92(4):1453-1469.
• [50] Pleiotropic combinatorial transcriptomes of human breast cancer cells exposed to mixtures of dietary phytoestrogens. Food Chem Toxicol. 2009 Apr;47(4):787-95.
• [51] Geraniol suppresses prostate cancer growth through down-regulation of E2F8. Cancer Med. 2016 Oct;5(10):2899-2908.
• [52] Gene expression profiling of 30 cancer cell lines predicts resistance towards 11 anticancer drugs at clinically achieved concentrations. Int J Cancer. 2006 Apr 1;118(7):1699-712. doi: 10.1002/ijc.21570.