Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT974IYI)

• DOT Name: DNA replication complex GINS protein PSF2 (GINS2)
• Synonyms: GINS complex subunit 2
• Gene Name: GINS2
• Related Disease:
  Alcohol use disorder
  Ankylosing spondylitis
  Cervical cancer
  Cervical carcinoma
  Coeliac disease
  Epithelial ovarian cancer
  Fanconi anemia complementation group A
  Fanconi's anemia
  Glioma
  Intrahepatic cholangiocarcinoma
  Non-small-cell lung cancer
  Ovarian cancer
  Progressive multifocal leukoencephalopathy
  Promyelocytic leukaemia
  Squamous cell carcinoma
  Thyroid cancer
  Thyroid gland carcinoma
  Thyroid tumor
  Advanced cancer
  Breast cancer
  Breast carcinoma
  Breast neoplasm
  Lung adenocarcinoma
  leukaemia
  Leukemia
  Melanoma
  Triple negative breast cancer
• UniProt ID: PSF2_HUMAN
• PDB ID: 2E9X; 2EHO; 2Q9Q; 6XTX; 6XTY; 7PFO; 7PLO; 8B9D
• Pfam ID: PF05916
• Sequence:
  MDAAEVEFLAEKELVTIIPNFSLDKIYLIGGDLGPFNPGLPVEVPLWLAINLKQRQKCRL
  LPPEWMDVEKLEKMRDHERKEETFTPMPSPYYMELTKLLLNHASDNIPKADEIRTLVKDM
  WDTRIAKLRVSADSFVRQQEAHAKLDNLTLMEINTSGTFLTQALNHMYKLRTNLQPLEST
  QSQDF
• Function: Required for correct functioning of the GINS complex, a complex that plays an essential role in the initiation of DNA replication, and progression of DNA replication forks. GINS complex is a core component of CDC45-MCM-GINS (CMG) helicase, the molecular machine that unwinds template DNA during replication, and around which the replisome is built.
• Reactome Pathway: Unwinding of DNA (R-HSA-176974)

Molecular Interaction Atlas (MIA) of This DOT

27 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Alcohol use disorder	DISMB65Y	Definitive	Altered Expression	[1]
Ankylosing spondylitis	DISRC6IR	Strong	Biomarker	[2]
Cervical cancer	DISFSHPF	Strong	Altered Expression	[3]
Cervical carcinoma	DIST4S00	Strong	Altered Expression	[3]
Coeliac disease	DISIY60C	Strong	Biomarker	[2]
Epithelial ovarian cancer	DIS56MH2	Strong	Altered Expression	[4]
Fanconi anemia complementation group A	DIS8PZLI	Strong	Biomarker	[5]
Fanconi's anemia	DISGW6Q8	Strong	Biomarker	[5]
Glioma	DIS5RPEH	Strong	Biomarker	[6]
Intrahepatic cholangiocarcinoma	DIS6GOC8	Strong	Altered Expression	[7]
Non-small-cell lung cancer	DIS5Y6R9	Strong	Altered Expression	[8]
Ovarian cancer	DISZJHAP	Strong	Altered Expression	[4]
Progressive multifocal leukoencephalopathy	DISX02WS	Strong	Biomarker	[9]
Promyelocytic leukaemia	DISYGG13	Strong	Altered Expression	[10]
Squamous cell carcinoma	DISQVIFL	Strong	Altered Expression	[3]
Thyroid cancer	DIS3VLDH	Strong	Biomarker	[11]
Thyroid gland carcinoma	DISMNGZ0	Strong	Biomarker	[11]
Thyroid tumor	DISLVKMD	Strong	Biomarker	[11]
Advanced cancer	DISAT1Z9	moderate	Altered Expression	[12]
Breast cancer	DIS7DPX1	moderate	Altered Expression	[13]
Breast carcinoma	DIS2UE88	moderate	Altered Expression	[13]
Breast neoplasm	DISNGJLM	moderate	Altered Expression	[14]
Lung adenocarcinoma	DISD51WR	moderate	Altered Expression	[14]
leukaemia	DISS7D1V	Limited	Altered Expression	[12]
Leukemia	DISNAKFL	Limited	Altered Expression	[12]
Melanoma	DIS1RRCY	Limited	Altered Expression	[12]
Triple negative breast cancer	DISAMG6N	Limited	Biomarker	[12]

36 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate affects the expression of DNA replication complex GINS protein PSF2 (GINS2).	[15]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of DNA replication complex GINS protein PSF2 (GINS2).	[16]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of DNA replication complex GINS protein PSF2 (GINS2).	[17]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of DNA replication complex GINS protein PSF2 (GINS2).	[18]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of DNA replication complex GINS protein PSF2 (GINS2).	[19]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of DNA replication complex GINS protein PSF2 (GINS2).	[20]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of DNA replication complex GINS protein PSF2 (GINS2).	[21]
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of DNA replication complex GINS protein PSF2 (GINS2).	[22]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of DNA replication complex GINS protein PSF2 (GINS2).	[23]
Arsenic	DMTL2Y1	Approved	Arsenic decreases the expression of DNA replication complex GINS protein PSF2 (GINS2).	[24]
Calcitriol	DM8ZVJ7	Approved	Calcitriol decreases the expression of DNA replication complex GINS protein PSF2 (GINS2).	[25]
Testosterone	DM7HUNW	Approved	Testosterone decreases the expression of DNA replication complex GINS protein PSF2 (GINS2).	[25]
Triclosan	DMZUR4N	Approved	Triclosan decreases the expression of DNA replication complex GINS protein PSF2 (GINS2).	[26]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of DNA replication complex GINS protein PSF2 (GINS2).	[15]
Methotrexate	DM2TEOL	Approved	Methotrexate decreases the expression of DNA replication complex GINS protein PSF2 (GINS2).	[27]
Zoledronate	DMIXC7G	Approved	Zoledronate decreases the expression of DNA replication complex GINS protein PSF2 (GINS2).	[28]
Phenobarbital	DMXZOCG	Approved	Phenobarbital affects the expression of DNA replication complex GINS protein PSF2 (GINS2).	[29]
Fluorouracil	DMUM7HZ	Approved	Fluorouracil affects the expression of DNA replication complex GINS protein PSF2 (GINS2).	[30]
Niclosamide	DMJAGXQ	Approved	Niclosamide decreases the expression of DNA replication complex GINS protein PSF2 (GINS2).	[31]
Cannabidiol	DM0659E	Approved	Cannabidiol decreases the expression of DNA replication complex GINS protein PSF2 (GINS2).	[32]
Troglitazone	DM3VFPD	Approved	Troglitazone decreases the expression of DNA replication complex GINS protein PSF2 (GINS2).	[33]
Azathioprine	DMMZSXQ	Approved	Azathioprine decreases the expression of DNA replication complex GINS protein PSF2 (GINS2).	[34]
Piroxicam	DMTK234	Approved	Piroxicam decreases the expression of DNA replication complex GINS protein PSF2 (GINS2).	[35]
Dasatinib	DMJV2EK	Approved	Dasatinib decreases the expression of DNA replication complex GINS protein PSF2 (GINS2).	[36]
Palbociclib	DMD7L94	Approved	Palbociclib decreases the expression of DNA replication complex GINS protein PSF2 (GINS2).	[37]
Urethane	DM7NSI0	Phase 4	Urethane decreases the expression of DNA replication complex GINS protein PSF2 (GINS2).	[38]
Genistein	DM0JETC	Phase 2/3	Genistein increases the expression of DNA replication complex GINS protein PSF2 (GINS2).	[22]
GSK2110183	DMZHB37	Phase 2	GSK2110183 decreases the expression of DNA replication complex GINS protein PSF2 (GINS2).	[39]
PEITC	DMOMN31	Phase 2	PEITC decreases the expression of DNA replication complex GINS protein PSF2 (GINS2).	[40]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of DNA replication complex GINS protein PSF2 (GINS2).	[41]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of DNA replication complex GINS protein PSF2 (GINS2).	[42]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of DNA replication complex GINS protein PSF2 (GINS2).	[43]
THAPSIGARGIN	DMDMQIE	Preclinical	THAPSIGARGIN decreases the expression of DNA replication complex GINS protein PSF2 (GINS2).	[45]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of DNA replication complex GINS protein PSF2 (GINS2).	[46]
Coumestrol	DM40TBU	Investigative	Coumestrol increases the expression of DNA replication complex GINS protein PSF2 (GINS2).	[47]
Deguelin	DMXT7WG	Investigative	Deguelin decreases the expression of DNA replication complex GINS protein PSF2 (GINS2).	[48]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 increases the phosphorylation of DNA replication complex GINS protein PSF2 (GINS2).	[44]
Coumarin	DM0N8ZM	Investigative	Coumarin increases the phosphorylation of DNA replication complex GINS protein PSF2 (GINS2).	[44]

References

• [1] GINS complex subunit 2 (GINS2) plays a protective role in alcohol-induced brain injury.Artif Cells Nanomed Biotechnol. 2019 Dec;47(1):1-9. doi: 10.1080/21691401.2018.1540425. Epub 2018 Dec 4.
• [2] Allelic variants of the human putative peptide transporter involved in antigen processing.Proc Natl Acad Sci U S A. 1992 May 1;89(9):3932-6. doi: 10.1073/pnas.89.9.3932.
• [3] GINS2 is a novel prognostic biomarker and promotes tumor progression in early-stage cervical cancer.Oncol Rep. 2017 May;37(5):2652-2662. doi: 10.3892/or.2017.5573. Epub 2017 Apr 11.
• [4] Prognostic values and prospective pathway signaling of MicroRNA-182 in ovarian cancer: a study based on gene expression omnibus (GEO) and bioinformatics analysis.J Ovarian Res. 2019 Nov 8;12(1):106. doi: 10.1186/s13048-019-0580-7.
• [5] Physical and functional crosstalk between Fanconi anemia core components and the GINS replication complex.DNA Repair (Amst). 2011 Feb 7;10(2):149-58. doi: 10.1016/j.dnarep.2010.10.006. Epub 2010 Nov 24.
• [6] Loss of GINS2 inhibits cell proliferation and tumorigenesis in human gliomas.CNS Neurosci Ther. 2019 Feb;25(2):273-287. doi: 10.1111/cns.13064. Epub 2018 Oct 18.
• [7] Up-regulation of PSF2, a member of the GINS multiprotein complex, in intrahepatic cholangiocarcinoma.Oncol Rep. 2005 Sep;14(3):701-6.
• [8] GINS2 facilitates epithelial-to-mesenchymal transition in non-small-cell lung cancer through modulating PI3K/Akt and MEK/ERK signaling.J Cell Physiol. 2020 Nov;235(11):7747-7756. doi: 10.1002/jcp.29381. Epub 2019 Nov 4.
• [9] Roles of GINS2 in K562 human chronic myelogenous leukemia and NB4 acute promyelocytic leukemia cells.Int J Mol Med. 2013 Jun;31(6):1402-10. doi: 10.3892/ijmm.2013.1339. Epub 2013 Apr 8.
• [10] Effect of GINS2 on proliferation and apoptosis in leukemic cell line.Int J Med Sci. 2013 Oct 30;10(12):1795-804. doi: 10.7150/ijms.7025. eCollection 2013.
• [11] GINS2 promotes cell proliferation and inhibits cell apoptosis in thyroid cancer by regulating CITED2 and LOXL2.Cancer Gene Ther. 2019 Mar;26(3-4):103-113. doi: 10.1038/s41417-018-0045-y. Epub 2018 Sep 4.
• [12] GINS2 regulates matrix metallopeptidase 9 expression and cancer stem cell property in human triple negative Breast cancer.Biomed Pharmacother. 2016 Dec;84:1568-1574. doi: 10.1016/j.biopha.2016.10.032. Epub 2016 Nov 6.
• [13] GINS2 regulates cell proliferation and apoptosis in human epithelial ovarian cancer.Oncol Lett. 2018 Aug;16(2):2591-2598. doi: 10.3892/ol.2018.8944. Epub 2018 Jun 11.
• [14] High GINS2 transcript level predicts poor prognosis and correlates with high histological grade and endocrine therapy resistance through mammary cancer stem cells in breast cancer patients.Breast Cancer Res Treat. 2014 Nov;148(2):423-36. doi: 10.1007/s10549-014-3172-7. Epub 2014 Oct 28.
• [15] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [16] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [17] Effect of retinoic acid on gene expression in human conjunctival epithelium: secretory phospholipase A2 mediates retinoic acid induction of MUC16. Invest Ophthalmol Vis Sci. 2005 Nov;46(11):4050-61.
• [18] Blood transcript immune signatures distinguish a subset of people with elevated serum ALT from others given acetaminophen. Clin Pharmacol Ther. 2016 Apr;99(4):432-41.
• [19] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [20] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [21] Low doses of cisplatin induce gene alterations, cell cycle arrest, and apoptosis in human promyelocytic leukemia cells. Biomark Insights. 2016 Aug 24;11:113-21.
• [22] Convergent transcriptional profiles induced by endogenous estrogen and distinct xenoestrogens in breast cancer cells. Carcinogenesis. 2006 Aug;27(8):1567-78.
• [23] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [24] Arsenic alters transcriptional responses to Pseudomonas aeruginosa infection and decreases antimicrobial defense of human airway epithelial cells. Toxicol Appl Pharmacol. 2017 Sep 15;331:154-163.
• [25] Effects of 1alpha,25 dihydroxyvitamin D3 and testosterone on miRNA and mRNA expression in LNCaP cells. Mol Cancer. 2011 May 18;10:58.
• [26] Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
• [27] Methotrexate modulates folate phenotype and inflammatory profile in EA.hy 926 cells. Eur J Pharmacol. 2014 Jun 5;732:60-7.
• [28] Interleukin-19 as a translational indicator of renal injury. Arch Toxicol. 2015 Jan;89(1):101-6.
• [29] Reproducible chemical-induced changes in gene expression profiles in human hepatoma HepaRG cells under various experimental conditions. Toxicol In Vitro. 2009 Apr;23(3):466-75. doi: 10.1016/j.tiv.2008.12.018. Epub 2008 Dec 30.
• [30] Multi-level gene expression profiles affected by thymidylate synthase and 5-fluorouracil in colon cancer. BMC Genomics. 2006 Apr 3;7:68. doi: 10.1186/1471-2164-7-68.
• [31] Mitochondrial Uncoupling Induces Epigenome Remodeling and Promotes Differentiation in Neuroblastoma. Cancer Res. 2023 Jan 18;83(2):181-194. doi: 10.1158/0008-5472.CAN-22-1029.
• [32] Cannabidiol enhances cytotoxicity of anti-cancer drugs in human head and neck squamous cell carcinoma. Sci Rep. 2020 Nov 26;10(1):20622. doi: 10.1038/s41598-020-77674-y.
• [33] Effects of ciglitazone and troglitazone on the proliferation of human stomach cancer cells. World J Gastroenterol. 2009 Jan 21;15(3):310-20.
• [34] A transcriptomics-based in vitro assay for predicting chemical genotoxicity in vivo. Carcinogenesis. 2012 Jul;33(7):1421-9.
• [35] Apoptosis induced by piroxicam plus cisplatin combined treatment is triggered by p21 in mesothelioma. PLoS One. 2011;6(8):e23569.
• [36] Dasatinib reverses cancer-associated fibroblasts (CAFs) from primary lung carcinomas to a phenotype comparable to that of normal fibroblasts. Mol Cancer. 2010 Jun 27;9:168.
• [37] Cdk4/6 inhibition induces epithelial-mesenchymal transition and enhances invasiveness in pancreatic cancer cells. Mol Cancer Ther. 2012 Oct;11(10):2138-48. doi: 10.1158/1535-7163.MCT-12-0562. Epub 2012 Aug 6.
• [38] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [39] Novel ATP-competitive Akt inhibitor afuresertib suppresses the proliferation of malignant pleural mesothelioma cells. Cancer Med. 2017 Nov;6(11):2646-2659. doi: 10.1002/cam4.1179. Epub 2017 Sep 27.
• [40] Phenethyl isothiocyanate alters the gene expression and the levels of protein associated with cell cycle regulation in human glioblastoma GBM 8401 cells. Environ Toxicol. 2017 Jan;32(1):176-187.
• [41] Transcriptional signature of human macrophages exposed to the environmental contaminant benzo(a)pyrene. Toxicol Sci. 2010 Apr;114(2):247-59.
• [42] Inhibition of BRD4 attenuates tumor cell self-renewal and suppresses stem cell signaling in MYC driven medulloblastoma. Oncotarget. 2014 May 15;5(9):2355-71.
• [43] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [44] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [45] Endoplasmic reticulum stress impairs insulin signaling through mitochondrial damage in SH-SY5Y cells. Neurosignals. 2012;20(4):265-80.
• [46] Bisphenol A induces DSB-ATM-p53 signaling leading to cell cycle arrest, senescence, autophagy, stress response, and estrogen release in human fetal lung fibroblasts. Arch Toxicol. 2018 Apr;92(4):1453-1469.
• [47] Pleiotropic combinatorial transcriptomes of human breast cancer cells exposed to mixtures of dietary phytoestrogens. Food Chem Toxicol. 2009 Apr;47(4):787-95.
• [48] Neurotoxicity and underlying cellular changes of 21 mitochondrial respiratory chain inhibitors. Arch Toxicol. 2021 Feb;95(2):591-615. doi: 10.1007/s00204-020-02970-5. Epub 2021 Jan 29.