Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTARUXQF)

• DOT Name: Transcriptional and immune response regulator (TCIM)
• Synonyms: Thyroid cancer protein 1; TC-1
• Gene Name: TCIM
• Related Disease:
  Acute lymphocytic leukaemia
  Acute myelogenous leukaemia
  Advanced cancer
  Bladder cancer
  Breast cancer
  Breast carcinoma
  Breast neoplasm
  Childhood acute lymphoblastic leukemia
  Colon cancer
  Colon carcinoma
  Colorectal carcinoma
  Gastric cancer
  Hepatocellular carcinoma
  Metastatic malignant neoplasm
  Myelodysplastic syndrome
  Plasma cell myeloma
  Pulmonary fibrosis
  Small lymphocytic lymphoma
  Stomach cancer
  Urinary bladder cancer
  Urinary bladder neoplasm
  Vitamin B12 deficiency
  Vulvar squamous intraepithelial lesion
  Lung cancer
  Lung carcinoma
  Thyroid cancer
  Thyroid gland carcinoma
  Thyroid gland papillary carcinoma
  Thyroid tumor
  Carcinoma of liver and intrahepatic biliary tract
  Liver cancer
  Neoplasm
  Parkinson disease
  Squamous cell carcinoma
• UniProt ID: TCIM_HUMAN
• Pfam ID: PF15063
• Sequence:
  MKAKRSHQAVIMSTSLRVSPSIHGYHFDTASRKKAVGNIFENTDQESLERLFRNSGDKKA
  EERAKIIFAIDQDVEEKTRALMALKKRTKDKLFQFLKLRKYSIKVH
• Function: Seems to be involved in the regulation of cell growth an differentiation, may play different and opposite roles depending on the tissue or cell type. May enhance the WNT-CTNNB1 pathway by relieving antagonistic activity of CBY1. Enhances the proliferation of follicular dendritic cells. Plays a role in the mitogen-activated MAPK2/3 signaling pathway, positively regulates G1-to-S-phase transition of the cell cycle. In endothelial cells, enhances key inflammatory mediators and inflammatory response through the modulation of NF-kappaB transcriptional regulatory activity. Involved in the regulation of heat shock response, seems to play a positive feedback with HSF1 to modulate heat-shock downstream gene expression. Plays a role in the regulation of hematopoiesis even if the mechanisms are unknown. In cancers such as thyroid or lung cancer, it has been described as promoter of cell proliferation, G1-to-S-phase transition and inhibitor of apoptosis. However, it negatively regulates self-renewal of liver cancer cells via suppresion of NOTCH2 signaling.
• Tissue Specificity: Ubiquitous. Expressed in thyroid papillary carcinoma. Expressed in liver, expression levels decrease in hepatocellular carcinoma . Slightly detected in normal lung, its expression is highly induced in lung cancer cells (at protein level) .

Molecular Interaction Atlas (MIA) of This DOT

34 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Acute lymphocytic leukaemia	DISPX75S	Strong	Genetic Variation	[1]
Acute myelogenous leukaemia	DISCSPTN	Strong	Genetic Variation	[1]
Advanced cancer	DISAT1Z9	Strong	Altered Expression	[2]
Bladder cancer	DISUHNM0	Strong	Biomarker	[3]
Breast cancer	DIS7DPX1	Strong	Biomarker	[4]
Breast carcinoma	DIS2UE88	Strong	Biomarker	[4]
Breast neoplasm	DISNGJLM	Strong	Altered Expression	[5]
Childhood acute lymphoblastic leukemia	DISJ5D6U	Strong	Genetic Variation	[1]
Colon cancer	DISVC52G	Strong	Biomarker	[6]
Colon carcinoma	DISJYKUO	Strong	Biomarker	[6]
Colorectal carcinoma	DIS5PYL0	Strong	Biomarker	[7]
Gastric cancer	DISXGOUK	Strong	Biomarker	[8]
Hepatocellular carcinoma	DIS0J828	Strong	Biomarker	[9]
Metastatic malignant neoplasm	DIS86UK6	Strong	Altered Expression	[6]
Myelodysplastic syndrome	DISYHNUI	Strong	Genetic Variation	[1]
Plasma cell myeloma	DIS0DFZ0	Strong	Genetic Variation	[1]
Pulmonary fibrosis	DISQKVLA	Strong	Posttranslational Modification	[10]
Small lymphocytic lymphoma	DIS30POX	Strong	Genetic Variation	[1]
Stomach cancer	DISKIJSX	Strong	Biomarker	[8]
Urinary bladder cancer	DISDV4T7	Strong	Biomarker	[3]
Urinary bladder neoplasm	DIS7HACE	Strong	Biomarker	[3]
Vitamin B12 deficiency	DIS91UJ1	Strong	Altered Expression	[11]
Vulvar squamous intraepithelial lesion	DISULIZR	Strong	Altered Expression	[2]
Lung cancer	DISCM4YA	moderate	Biomarker	[4]
Lung carcinoma	DISTR26C	moderate	Biomarker	[4]
Thyroid cancer	DIS3VLDH	Disputed	Genetic Variation	[12]
Thyroid gland carcinoma	DISMNGZ0	Disputed	Genetic Variation	[12]
Thyroid gland papillary carcinoma	DIS48YMM	Disputed	Biomarker	[13]
Thyroid tumor	DISLVKMD	Disputed	Genetic Variation	[12]
Carcinoma of liver and intrahepatic biliary tract	DIS8WA0W	Limited	Biomarker	[14]
Liver cancer	DISDE4BI	Limited	Biomarker	[14]
Neoplasm	DISZKGEW	Limited	Biomarker	[14]
Parkinson disease	DISQVHKL	Limited	Biomarker	[15]
Squamous cell carcinoma	DISQVIFL	Limited	Altered Expression	[12]

This DOT Affected the Drug Response of 2 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Temozolomide	DMKECZD	Approved	Transcriptional and immune response regulator (TCIM) increases the response to substance of Temozolomide.	[43]
DTI-015	DMXZRW0	Approved	Transcriptional and immune response regulator (TCIM) increases the response to substance of DTI-015.	[43]

29 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Transcriptional and immune response regulator (TCIM).	[16]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Transcriptional and immune response regulator (TCIM).	[17]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Transcriptional and immune response regulator (TCIM).	[18]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Transcriptional and immune response regulator (TCIM).	[19]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Transcriptional and immune response regulator (TCIM).	[20]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of Transcriptional and immune response regulator (TCIM).	[21]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of Transcriptional and immune response regulator (TCIM).	[22]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Transcriptional and immune response regulator (TCIM).	[23]
Quercetin	DM3NC4M	Approved	Quercetin decreases the expression of Transcriptional and immune response regulator (TCIM).	[24]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide increases the expression of Transcriptional and immune response regulator (TCIM).	[25]
Calcitriol	DM8ZVJ7	Approved	Calcitriol increases the expression of Transcriptional and immune response regulator (TCIM).	[26]
Testosterone	DM7HUNW	Approved	Testosterone increases the expression of Transcriptional and immune response regulator (TCIM).	[26]
Triclosan	DMZUR4N	Approved	Triclosan decreases the expression of Transcriptional and immune response regulator (TCIM).	[27]
Zoledronate	DMIXC7G	Approved	Zoledronate increases the expression of Transcriptional and immune response regulator (TCIM).	[28]
Fulvestrant	DM0YZC6	Approved	Fulvestrant increases the expression of Transcriptional and immune response regulator (TCIM).	[23]
Folic acid	DMEMBJC	Approved	Folic acid increases the expression of Transcriptional and immune response regulator (TCIM).	[29]
Niclosamide	DMJAGXQ	Approved	Niclosamide increases the expression of Transcriptional and immune response regulator (TCIM).	[30]
Liothyronine	DM6IR3P	Approved	Liothyronine increases the expression of Transcriptional and immune response regulator (TCIM).	[31]
Urethane	DM7NSI0	Phase 4	Urethane decreases the expression of Transcriptional and immune response regulator (TCIM).	[32]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 decreases the expression of Transcriptional and immune response regulator (TCIM).	[33]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the expression of Transcriptional and immune response regulator (TCIM).	[34]
Leflunomide	DMR8ONJ	Phase 1 Trial	Leflunomide increases the expression of Transcriptional and immune response regulator (TCIM).	[35]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the expression of Transcriptional and immune response regulator (TCIM).	[36]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A decreases the expression of Transcriptional and immune response regulator (TCIM).	[37]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde increases the expression of Transcriptional and immune response regulator (TCIM).	[38]
Sulforaphane	DMQY3L0	Investigative	Sulforaphane decreases the expression of Transcriptional and immune response regulator (TCIM).	[39]
Nickel chloride	DMI12Y8	Investigative	Nickel chloride increases the expression of Transcriptional and immune response regulator (TCIM).	[40]
Manganese	DMKT129	Investigative	Manganese increases the expression of Transcriptional and immune response regulator (TCIM).	[41]
CH-223191	DMMJZYC	Investigative	CH-223191 increases the expression of Transcriptional and immune response regulator (TCIM).	[42]

References

• [1] Investigation of copy-number variations of C8orf4 in hematological malignancies.Med Oncol. 2011 Dec;28 Suppl 1:S647-52. doi: 10.1007/s12032-010-9698-6. Epub 2010 Sep 29.
• [2] Association of C8orf4 expression with its methylation status, aberrant -catenin expression, and the development of cervical squamous cell carcinoma.Medicine (Baltimore). 2019 Aug;98(31):e16715. doi: 10.1097/MD.0000000000016715.
• [3] Comprehensive analysis of differentially expressed profiles of lncRNAs and circRNAs with associated co-expression and ceRNA networks in bladder carcinoma.Oncotarget. 2016 Jul 26;7(30):47186-47200. doi: 10.18632/oncotarget.9706.
• [4] TC-1 (c8orf4) enhances aggressive biologic behavior in lung cancer through the Wnt/-catenin pathway.J Surg Res. 2013 Nov;185(1):255-63. doi: 10.1016/j.jss.2013.05.075. Epub 2013 Jun 11.
• [5] Transforming properties of TC-1 in human breast cancer: interaction with FGFR2 and beta-catenin signaling pathways.Int J Cancer. 2007 Sep 15;121(6):1265-73. doi: 10.1002/ijc.22831.
• [6] C8orf4 is a transforming growth factor B induced transcript downregulated in metastatic colon cancer.Int J Cancer. 2004 Aug 10;111(1):72-5. doi: 10.1002/ijc.20235.
• [7] The density of Tbet+ tumor-infiltrating T lymphocytes reflects an effective and druggable preexisting adaptive antitumor immune response in colorectal cancer, irrespective of the microsatellite status.Oncoimmunology. 2019 Jan 19;8(4):e1562834. doi: 10.1080/2162402X.2018.1562834. eCollection 2019.
• [8] TC1(C8orf4) correlates with Wnt/beta-catenin target genes and aggressive biological behavior in gastric cancer.Clin Cancer Res. 2006 Jun 1;12(11 Pt 1):3541-8. doi: 10.1158/1078-0432.CCR-05-2440.
• [9] 1810011o10 Rik Inhibits the Antitumor Effect of Intratumoral CD8(+) T Cells through Suppression of Notch2 Pathway in a Murine Hepatocellular Carcinoma Model.Front Immunol. 2017 Mar 22;8:320. doi: 10.3389/fimmu.2017.00320. eCollection 2017.
• [10] Epigenetic regulation of cyclooxygenase-2 by methylation of c8orf4 in pulmonary fibrosis.Clin Sci (Lond). 2016 Apr;130(8):575-86. doi: 10.1042/CS20150697. Epub 2016 Jan 7.
• [11] Genomic mutations associated with mild and severe deficiencies of transcobalamin I (haptocorrin) that cause mildly and severely low serum cobalamin levels.Br J Haematol. 2009 Nov;147(3):386-91. doi: 10.1111/j.1365-2141.2009.07855.x. Epub 2009 Aug 17.
• [12] The high expression of TC1 (C8orf4) was correlated with the expression of -catenin and cyclin D1 and the progression of squamous cell carcinomas of the tongue.Tumour Biol. 2015 Sep;36(9):7061-7. doi: 10.1007/s13277-015-3423-1. Epub 2015 Apr 14.
• [13] Circular RNA circZFR contributes to papillary thyroid cancer cell proliferation and invasion by sponging miR-1261 and facilitating C8orf4 expression.Biochem Biophys Res Commun. 2018 Sep 3;503(1):56-61. doi: 10.1016/j.bbrc.2018.05.174. Epub 2018 Jun 8.
• [14] C8orf4 negatively regulates self-renewal of liver cancer stem cells via suppression of NOTCH2 signalling.Nat Commun. 2015 May 19;6:7122. doi: 10.1038/ncomms8122.
• [15] Genomic determinants of motor and cognitive outcomes in Parkinson's disease.Parkinsonism Relat Disord. 2012 Aug;18(7):881-6. doi: 10.1016/j.parkreldis.2012.04.025. Epub 2012 May 30.
• [16] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [17] Integrative "-Omics" analysis in primary human hepatocytes unravels persistent mechanisms of cyclosporine A-induced cholestasis. Chem Res Toxicol. 2016 Dec 19;29(12):2164-2174.
• [18] Development of a neural teratogenicity test based on human embryonic stem cells: response to retinoic acid exposure. Toxicol Sci. 2011 Dec;124(2):370-7.
• [19] Blood transcript immune signatures distinguish a subset of people with elevated serum ALT from others given acetaminophen. Clin Pharmacol Ther. 2016 Apr;99(4):432-41.
• [20] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [21] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [22] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [23] Arsenite and cadmium promote the development of mammary tumors. Carcinogenesis. 2020 Jul 14;41(7):1005-1014. doi: 10.1093/carcin/bgz176.
• [24] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [25] Arsenic suppresses gene expression in promyelocytic leukemia cells partly through Sp1 oxidation. Blood. 2005 Jul 1;106(1):304-10.
• [26] Effects of 1alpha,25 dihydroxyvitamin D3 and testosterone on miRNA and mRNA expression in LNCaP cells. Mol Cancer. 2011 May 18;10:58.
• [27] Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
• [28] Interleukin-19 as a translational indicator of renal injury. Arch Toxicol. 2015 Jan;89(1):101-6.
• [29] Folic acid supplementation dysregulates gene expression in lymphoblastoid cells--implications in nutrition. Biochem Biophys Res Commun. 2011 Sep 9;412(4):688-92. doi: 10.1016/j.bbrc.2011.08.027. Epub 2011 Aug 16.
• [30] Computational discovery of niclosamide ethanolamine, a repurposed drug candidate that reduces growth of hepatocellular carcinoma cells initro and in mice by inhibiting cell division cycle 37 signaling. Gastroenterology. 2017 Jun;152(8):2022-2036.
• [31] Similarities and differences between two modes of antagonism of the thyroid hormone receptor. ACS Chem Biol. 2011 Oct 21;6(10):1096-106.
• [32] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [33] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [34] New insights into BaP-induced toxicity: role of major metabolites in transcriptomics and contribution to hepatocarcinogenesis. Arch Toxicol. 2016 Jun;90(6):1449-58.
• [35] Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
• [36] Low dose of bisphenol a modulates ovarian cancer gene expression profile and promotes epithelial to mesenchymal transition via canonical Wnt pathway. Toxicol Sci. 2018 Aug 1;164(2):527-538.
• [37] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [38] Gene expression changes in primary human nasal epithelial cells exposed to formaldehyde in vitro. Toxicol Lett. 2010 Oct 5;198(2):289-95.
• [39] Transcriptome and DNA methylation changes modulated by sulforaphane induce cell cycle arrest, apoptosis, DNA damage, and suppression of proliferation in human liver cancer cells. Food Chem Toxicol. 2020 Feb;136:111047. doi: 10.1016/j.fct.2019.111047. Epub 2019 Dec 12.
• [40] The contact allergen nickel triggers a unique inflammatory and proangiogenic gene expression pattern via activation of NF-kappaB and hypoxia-inducible factor-1alpha. J Immunol. 2007 Mar 1;178(5):3198-207.
• [41] Gene expression profiling of human primary astrocytes exposed to manganese chloride indicates selective effects on several functions of the cells. Neurotoxicology. 2007 May;28(3):478-89.
• [42] Adaptive changes in global gene expression profile of lung carcinoma A549 cells acutely exposed to distinct types of AhR ligands. Toxicol Lett. 2018 Aug;292:162-174.
• [43] Tumor necrosis factor-alpha-induced protein 3 as a putative regulator of nuclear factor-kappaB-mediated resistance to O6-alkylating agents in human glioblastomas. J Clin Oncol. 2006 Jan 10;24(2):274-87. doi: 10.1200/JCO.2005.02.9405. Epub 2005 Dec 19.