Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTB3BFCV)

• DOT Name: Heterogeneous nuclear ribonucleoprotein D-like (HNRNPDL)
• Synonyms: hnRNP D-like; hnRNP DL; AU-rich element RNA-binding factor; JKT41-binding protein; Protein laAUF1
• Gene Name: HNRNPDL
• Related Disease:
  Prostate cancer
  Prostate carcinoma
  Alzheimer disease
  Amyotrophic lateral sclerosis
  Autosomal dominant limb-girdle muscular dystrophy type 1G
  Bladder cancer
  Colon cancer
  Colon carcinoma
  Colorectal carcinoma
  Gastric cancer
  Hepatitis C virus infection
  Hepatocellular carcinoma
  Herpes simplex infection
  Limb-girdle muscular dystrophy
  Lupus
  Meningioma
  Mixed connective tissue disease
  Neuroblastoma
  Non-small-cell lung cancer
  Rheumatoid arthritis
  Schizophrenia
  Stomach cancer
  Systemic lupus erythematosus
  Urinary bladder cancer
  Urinary bladder neoplasm
  Breast cancer
  Breast carcinoma
  Muscular dystrophy, limb-girdle, autosomal dominant
  Intellectual disability
  Adult glioblastoma
  Carcinoma of liver and intrahepatic biliary tract
  Castration-resistant prostate carcinoma
  Enterovirus infection
  Frontotemporal dementia
  Glioblastoma multiforme
  Glioma
  Hypoglycemia
  leukaemia
  Leukemia
  Liver cancer
  Myopathy
  Myotonic dystrophy type 1
• UniProt ID: HNRDL_HUMAN
• PDB ID: 7ZIR
• Pfam ID: PF00076
• Sequence:
  MEVPPRLSHVPPPLFPSAPATLASRSLSHWRPRPPRQLAPLLPSLAPSSARQGARRAQRH
  VTAQQPSRLAGGAAIKGGRRRRPDLFRRHFKSSSIQRSAAAAAATRTARQHPPADSSVTM
  EDMNEYSNIEEFAEGSKINASKNQQDDGKMFIGGLSWDTSKKDLTEYLSRFGEVVDCTIK
  TDPVTGRSRGFGFVLFKDAASVDKVLELKEHKLDGKLIDPKRAKALKGKEPPKKVFVGGL
  SPDTSEEQIKEYFGAFGEIENIELPMDTKTNERRGFCFITYTDEEPVKKLLESRYHQIGS
  GKCEIKVAQPKEVYRQQQQQQKGGRGAAAGGRGGTRGRGRGQGQNWNQGFNNYYDQGYGN
  YNSAYGGDQNYSGYGGYDYTGYNYGNYGYGQGYADYSGQQSTYGKASRGGGNHQNNYQPY
• Function: Acts as a transcriptional regulator. Promotes transcription repression. Promotes transcription activation in differentiated myotubes. Binds to double- and single-stranded DNA sequences. Binds to the transcription suppressor CATR sequence of the COX5B promoter. Binds with high affinity to RNA molecules that contain AU-rich elements (AREs) found within the 3'-UTR of many proto-oncogenes and cytokine mRNAs. Binds both to nuclear and cytoplasmic poly(A) mRNAs. Binds to poly(G) and poly(A), but not to poly(U) or poly(C) RNA homopolymers. Binds to the 5'-ACUAGC-3' RNA consensus sequence.
• Tissue Specificity: Expressed in heart, brain, placenta, lung, liver, skeletal muscle, kidney, pancreas, spleen, thymus, prostate, testis, ovary, small intestine, colon and leukocytes. Expressed in myeloid leukemia, gastric adenocarcinoma, cervical carcinoma, hepatoma, fibrosarcoma, colon adenocarcinoma, epidermoid carcinoma, osteosarcoma and urinary bladder carcinoma cells.
• Reactome Pathway: Gene and protein expression by JAK-STAT signaling after Interleukin-12 stimulation (R-HSA-8950505)

Molecular Interaction Atlas (MIA) of This DOT

42 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Prostate cancer	DISF190Y	Definitive	Biomarker	[1]
Prostate carcinoma	DISMJPLE	Definitive	Biomarker	[1]
Alzheimer disease	DISF8S70	Strong	Altered Expression	[2]
Amyotrophic lateral sclerosis	DISF7HVM	Strong	Biomarker	[3]
Autosomal dominant limb-girdle muscular dystrophy type 1G	DIS5DALU	Strong	Autosomal dominant	[4]
Bladder cancer	DISUHNM0	Strong	Altered Expression	[5]
Colon cancer	DISVC52G	Strong	Altered Expression	[6]
Colon carcinoma	DISJYKUO	Strong	Altered Expression	[6]
Colorectal carcinoma	DIS5PYL0	Strong	Biomarker	[7]
Gastric cancer	DISXGOUK	Strong	Biomarker	[8]
Hepatitis C virus infection	DISQ0M8R	Strong	Biomarker	[9]
Hepatocellular carcinoma	DIS0J828	Strong	Biomarker	[10]
Herpes simplex infection	DISL1SAV	Strong	Biomarker	[11]
Limb-girdle muscular dystrophy	DISI9Y1Z	Strong	Genetic Variation	[12]
Lupus	DISOKJWA	Strong	Biomarker	[13]
Meningioma	DISPT4TG	Strong	Altered Expression	[14]
Mixed connective tissue disease	DISXX0H8	Strong	Biomarker	[15]
Neuroblastoma	DISVZBI4	Strong	Altered Expression	[16]
Non-small-cell lung cancer	DIS5Y6R9	Strong	Posttranslational Modification	[17]
Rheumatoid arthritis	DISTSB4J	Strong	Biomarker	[15]
Schizophrenia	DISSRV2N	Strong	Altered Expression	[16]
Stomach cancer	DISKIJSX	Strong	Biomarker	[8]
Systemic lupus erythematosus	DISI1SZ7	Strong	Biomarker	[13]
Urinary bladder cancer	DISDV4T7	Strong	Altered Expression	[5]
Urinary bladder neoplasm	DIS7HACE	Strong	Altered Expression	[5]
Breast cancer	DIS7DPX1	moderate	Altered Expression	[18]
Breast carcinoma	DIS2UE88	moderate	Altered Expression	[18]
Muscular dystrophy, limb-girdle, autosomal dominant	DISMMHPT	Moderate	Autosomal dominant	[19]
Intellectual disability	DISMBNXP	Disputed	Genetic Variation	[20]
Adult glioblastoma	DISVP4LU	Limited	Altered Expression	[21]
Carcinoma of liver and intrahepatic biliary tract	DIS8WA0W	Limited	Altered Expression	[22]
Castration-resistant prostate carcinoma	DISVGAE6	Limited	Biomarker	[23]
Enterovirus infection	DISH2UDP	Limited	Altered Expression	[24]
Frontotemporal dementia	DISKYHXL	Limited	Biomarker	[3]
Glioblastoma multiforme	DISK8246	Limited	Altered Expression	[21]
Glioma	DIS5RPEH	Limited	Altered Expression	[25]
Hypoglycemia	DISRCKR7	Limited	Altered Expression	[25]
leukaemia	DISS7D1V	Limited	Biomarker	[26]
Leukemia	DISNAKFL	Limited	Biomarker	[26]
Liver cancer	DISDE4BI	Limited	Altered Expression	[22]
Myopathy	DISOWG27	Limited	Biomarker	[27]
Myotonic dystrophy type 1	DISJC0OX	Limited	Biomarker	[28]

This DOT Affected the Drug Response of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Topotecan	DMP6G8T	Approved	Heterogeneous nuclear ribonucleoprotein D-like (HNRNPDL) affects the response to substance of Topotecan.	[45]

16 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Heterogeneous nuclear ribonucleoprotein D-like (HNRNPDL).	[29]
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Heterogeneous nuclear ribonucleoprotein D-like (HNRNPDL).	[30]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Heterogeneous nuclear ribonucleoprotein D-like (HNRNPDL).	[31]
Doxorubicin	DMVP5YE	Approved	Doxorubicin increases the expression of Heterogeneous nuclear ribonucleoprotein D-like (HNRNPDL).	[32]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Heterogeneous nuclear ribonucleoprotein D-like (HNRNPDL).	[33]
Quercetin	DM3NC4M	Approved	Quercetin decreases the expression of Heterogeneous nuclear ribonucleoprotein D-like (HNRNPDL).	[34]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide affects the expression of Heterogeneous nuclear ribonucleoprotein D-like (HNRNPDL).	[35]
Demecolcine	DMCZQGK	Approved	Demecolcine decreases the expression of Heterogeneous nuclear ribonucleoprotein D-like (HNRNPDL).	[36]
Aspirin	DM672AH	Approved	Aspirin decreases the expression of Heterogeneous nuclear ribonucleoprotein D-like (HNRNPDL).	[37]
Irinotecan	DMP6SC2	Approved	Irinotecan decreases the expression of Heterogeneous nuclear ribonucleoprotein D-like (HNRNPDL).	[38]
Acocantherin	DM7JT24	Approved	Acocantherin decreases the expression of Heterogeneous nuclear ribonucleoprotein D-like (HNRNPDL).	[39]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of Heterogeneous nuclear ribonucleoprotein D-like (HNRNPDL).	[40]
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 decreases the expression of Heterogeneous nuclear ribonucleoprotein D-like (HNRNPDL).	[41]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Heterogeneous nuclear ribonucleoprotein D-like (HNRNPDL).	[42]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde decreases the expression of Heterogeneous nuclear ribonucleoprotein D-like (HNRNPDL).	[43]
Milchsaure	DM462BT	Investigative	Milchsaure increases the expression of Heterogeneous nuclear ribonucleoprotein D-like (HNRNPDL).	[44]

References

• [1] Dysregulation of miR-212 Promotes Castration Resistance through hnRNPH1-Mediated Regulation of AR and AR-V7: Implications for Racial Disparity of Prostate Cancer.Clin Cancer Res. 2016 Apr 1;22(7):1744-56. doi: 10.1158/1078-0432.CCR-15-1606. Epub 2015 Nov 9.
• [2] Opposite Dysregulation of Fragile-X Mental Retardation Protein and Heteronuclear Ribonucleoprotein C Protein Associates with Enhanced APP Translation in Alzheimer Disease.Mol Neurobiol. 2016 Jul;53(5):3227-3234. doi: 10.1007/s12035-015-9229-8. Epub 2015 Jun 6.
• [3] Linking hnRNP Function to ALS and FTD Pathology.Front Neurosci. 2018 May 15;12:326. doi: 10.3389/fnins.2018.00326. eCollection 2018.
• [4] A defect in the RNA-processing protein HNRPDL causes limb-girdle muscular dystrophy 1G (LGMD1G). Hum Mol Genet. 2014 Aug 1;23(15):4103-10. doi: 10.1093/hmg/ddu127. Epub 2014 Mar 18.
• [5] Decreased c-Myc mRNA Stability via the MicroRNA 141-3p/AUF1 Axis Is Crucial for p63 Inhibition of Cyclin D1 Gene Transcription and Bladder Cancer Cell Tumorigenicity.Mol Cell Biol. 2018 Oct 15;38(21):e00273-18. doi: 10.1128/MCB.00273-18. Print 2018 Nov 1.
• [6] Oncogenic heterogeneous nuclear ribonucleoprotein D-like promotes the growth of human colon cancer SW620 cells via its regulation of cell-cycle.Acta Biochim Biophys Sin (Shanghai). 2018 Sep 1;50(9):880-887. doi: 10.1093/abbs/gmy085.
• [7] LINC01354 interacting with hnRNP-D contributes to the proliferation and metastasis in colorectal cancer through activating Wnt/-catenin signaling pathway.J Exp Clin Cancer Res. 2019 Apr 15;38(1):161. doi: 10.1186/s13046-019-1150-y.
• [8] HnRNPR-CCNB1/CENPF axis contributes to gastric cancer proliferation and metastasis.Aging (Albany NY). 2019 Sep 16;11(18):7473-7491. doi: 10.18632/aging.102254. Epub 2019 Sep 16.
• [9] hnRNP L and NF90 interact with hepatitis C virus 5'-terminal untranslated RNA and promote efficient replication.J Virol. 2014 Jul;88(13):7199-209. doi: 10.1128/JVI.00225-14. Epub 2014 Apr 9.
• [10] Long noncoding RNA NEAT1 promotes cell proliferation and invasion by regulating hnRNP A2 expression in hepatocellular carcinoma cells.Onco Targets Ther. 2017 Feb 20;10:1003-1016. doi: 10.2147/OTT.S116319. eCollection 2017.
• [11] Redistribution of nuclear ribonucleoprotein antigens during herpes simplex virus infection.J Cell Biol. 1987 Nov;105(5):2069-82. doi: 10.1083/jcb.105.5.2069.
• [12] Limb girdle muscular dystrophy D3 HNRNPDL related in a Chinese family with distal muscle weakness caused by a mutation in the prion-like domain.J Neurol. 2019 Feb;266(2):498-506. doi: 10.1007/s00415-018-9165-4. Epub 2019 Jan 2.
• [13] Neuronal BC RNA Transport Impairments Caused by Systemic Lupus Erythematosus Autoantibodies.J Neurosci. 2019 Sep 25;39(39):7759-7777. doi: 10.1523/JNEUROSCI.1657-18.2019. Epub 2019 Aug 12.
• [14] LGR5 and Downstream Intracellular Signaling Proteins Play Critical Roles in the Cell Proliferation of Neuroblastoma, Meningioma and Pituitary Adenoma.Exp Neurobiol. 2019 Oct 31;28(5):628-641. doi: 10.5607/en.2019.28.5.628.
• [15] Identification of autoantibodies to the I protein of the heterogeneous nuclear ribonucleoprotein complex in patients with systemic sclerosis.Arthritis Rheum. 1996 Oct;39(10):1669-76. doi: 10.1002/art.1780391009.
• [16] Altering the expression balance of hnRNP C1 and C2 changes the expression of myelination-related genes.Psychiatry Res. 2011 Dec 30;190(2-3):364-6. doi: 10.1016/j.psychres.2011.05.043.
• [17] Living or dying by RNA processing: caspase expression in NSCLC.J Clin Invest. 2010 Nov;120(11):3798-801. doi: 10.1172/JCI45037. Epub 2010 Oct 25.
• [18] Heterogenous ribonucleoprotein A18 (hnRNP A18) promotes tumor growth by increasing protein translation of selected transcripts in cancer cells.Oncotarget. 2016 Mar 1;7(9):10578-93. doi: 10.18632/oncotarget.7020.
• [19] Technical standards for the interpretation and reporting of constitutional copy-number variants: a joint consensus recommendation of the American College of Medical Genetics and Genomics (ACMG) and the Clinical Genome Resource (ClinGen). Genet Med. 2020 Feb;22(2):245-257. doi: 10.1038/s41436-019-0686-8. Epub 2019 Nov 6.
• [20] Further defining the critical genes for the 4q21 microdeletion disorder.Am J Med Genet A. 2017 Jan;173(1):120-125. doi: 10.1002/ajmg.a.37965. Epub 2016 Sep 8.
• [21] Human cytomegalovirus ie2 affects the migration of glioblastoma by mediating the different splicing patterns of RON through hnRNP A2B1.Neuroreport. 2019 Aug 14;30(12):805-811. doi: 10.1097/WNR.0000000000001277.
• [22] Splicing factor hnRNP A2 activates the Ras-MAPK-ERK pathway by controlling A-Raf splicing in hepatocellular carcinoma development.RNA. 2014 Apr;20(4):505-15. doi: 10.1261/rna.042259.113. Epub 2014 Feb 26.
• [23] Manumycin A suppresses exosome biogenesis and secretion via targeted inhibition of Ras/Raf/ERK1/2 signaling and hnRNP H1 in castration-resistant prostate cancer cells.Cancer Lett. 2017 Nov 1;408:73-81. doi: 10.1016/j.canlet.2017.08.020. Epub 2017 Aug 24.
• [24] Apigenin inhibits enterovirus-71 infection by disrupting viral RNA association with trans-acting factors.PLoS One. 2014 Oct 16;9(10):e110429. doi: 10.1371/journal.pone.0110429. eCollection 2014.
• [25] hnRNP A2 and hnRNP L bind the 3'UTR of glucose transporter 1 mRNA and exist as a complex in vivo.Biochem Biophys Res Commun. 1999 Aug 11;261(3):646-51. doi: 10.1006/bbrc.1999.1040.
• [26] Oncogenic heterogeneous nuclear ribonucleoprotein D-like modulates the growth and imatinib response of human chronic myeloid leukemia CD34(+) cells via pre-B-cell leukemia homeobox 1.Oncogene. 2020 Jan;39(2):443-453. doi: 10.1038/s41388-019-0998-9. Epub 2019 Sep 5.
• [27] HNRNPDL-related muscular dystrophy: expanding the clinical, morphological and MRI phenotypes.J Neurol. 2019 Oct;266(10):2524-2534. doi: 10.1007/s00415-019-09437-3. Epub 2019 Jul 2.
• [28] In vivo co-localisation of MBNL protein with DMPK expanded-repeat transcripts.Nucleic Acids Res. 2001 Jul 1;29(13):2766-71. doi: 10.1093/nar/29.13.2766.
• [29] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [30] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [31] Systems analysis of transcriptome and proteome in retinoic acid/arsenic trioxide-induced cell differentiation/apoptosis of promyelocytic leukemia. Proc Natl Acad Sci U S A. 2005 May 24;102(21):7653-8.
• [32] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [33] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [34] Integrated assessment by multiple gene expression analysis of quercetin bioactivity on anticancer-related mechanisms in colon cancer cells in vitro. Eur J Nutr. 2005 Mar;44(3):143-56. doi: 10.1007/s00394-004-0503-1. Epub 2004 Apr 30.
• [35] Minimal peroxide exposure of neuronal cells induces multifaceted adaptive responses. PLoS One. 2010 Dec 17;5(12):e14352. doi: 10.1371/journal.pone.0014352.
• [36] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
• [37] Effects of aspirin on metastasis-associated gene expression detected by cDNA microarray. Acta Pharmacol Sin. 2004 Oct;25(10):1327-33.
• [38] Clinical determinants of response to irinotecan-based therapy derived from cell line models. Clin Cancer Res. 2008 Oct 15;14(20):6647-55.
• [39] Ouabain at pathological concentrations might induce damage in human vascular endothelial cells. Acta Pharmacol Sin. 2006 Feb;27(2):165-72. doi: 10.1111/j.1745-7254.2006.00244.x.
• [40] Transcriptional signature of human macrophages exposed to the environmental contaminant benzo(a)pyrene. Toxicol Sci. 2010 Apr;114(2):247-59.
• [41] Comparative proteomics reveals concordant and discordant biochemical effects of caffeine versus epigallocatechin-3-gallate in human endothelial cells. Toxicol Appl Pharmacol. 2019 Sep 1;378:114621. doi: 10.1016/j.taap.2019.114621. Epub 2019 Jun 10.
• [42] Identification of mechanisms of action of bisphenol a-induced human preadipocyte differentiation by transcriptional profiling. Obesity (Silver Spring). 2014 Nov;22(11):2333-43.
• [43] Gene expression changes in primary human nasal epithelial cells exposed to formaldehyde in vitro. Toxicol Lett. 2010 Oct 5;198(2):289-95.
• [44] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
• [45] Gene expression profiling of 30 cancer cell lines predicts resistance towards 11 anticancer drugs at clinically achieved concentrations. Int J Cancer. 2006 Apr 1;118(7):1699-712. doi: 10.1002/ijc.21570.