Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTB6NA5O)

DOT Name	Chymotrypsin-like protease CTRL-1 (CTRL)
Synonyms	EC 3.4.21.-
Gene Name	CTRL
Related Disease	Cognitive impairment ( ) Acute myocardial infarction ( ) Alzheimer disease ( ) Amyotrophic lateral sclerosis type 1 ( ) Analgesia ( ) Anxiety ( ) Anxiety disorder ( ) Atopic dermatitis ( ) Atrial fibrillation ( ) Autosomal dominant optic atrophy, classic form ( ) Autosomal dominant polycystic kidney disease ( ) Breast cancer ( ) Breast carcinoma ( ) Cardiac failure ( ) Cardiovascular disease ( ) Chikungunya virus infection ( ) Congestive heart failure ( ) Coronary heart disease ( ) Depression ( ) Dilated cardiomyopathy 1A ( ) Exocrine pancreatic insufficiency ( ) Knee osteoarthritis ( ) Non-alcoholic fatty liver disease ( ) Oral lichen planus ( ) Oropharyngeal squamous cell carcinoma ( ) Plasma cell myeloma ( ) Prostate cancer ( ) Prostate neoplasm ( ) Schizophrenia ( ) Systemic lupus erythematosus ( ) High blood pressure ( ) Obesity ( ) Pancreatic cancer ( ) Polycystic ovarian syndrome ( ) Prostate carcinoma ( ) Advanced cancer ( ) Chronic pancreatitis ( ) Hepatocellular carcinoma ( ) Neoplasm ( ) Non-insulin dependent diabetes ( ) Severe acute respiratory syndrome (SARS) ( ) Spinocerebellar ataxia type 3 ( ) Type-1 diabetes ( ) Waldenstrom macroglobulinemia ( )
UniProt ID	CTRL_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
EC Number	3.4.21.-
Pfam ID	PF00089
Sequence	MLLLSLTLSLVLLGSSWGCGIPAIKPALSFSQRIVNGENAVLGSWPWQVSLQDSSGFHFC GGSLISQSWVVTAAHCNVSPGRHFVVLGEYDRSSNAEPLQVLSVSRAITHPSWNSTTMNN DVTLLKLASPAQYTTRISPVCLASSNEALTEGLTCVTTGWGRLSGVGNVTPAHLQQVALP LVTVNQCRQYWGSSITDSMICAGGAGASSCQGDSGGPLVCQKGNTWVLIGIVSWGTKNCN VRAPAVYTRVSKFSTWINQVIAYN
KEGG Pathway	Pancreatic secretion (hsa04972 ) Protein digestion and absorption (hsa04974 )

Molecular Interaction Atlas (MIA) of This DOT

44 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance
Cognitive impairment	DISH2ERD	Definitive	Genetic Variation	[1]
Acute myocardial infarction	DISE3HTG	Strong	Genetic Variation	[2]
Alzheimer disease	DISF8S70	Strong	Biomarker	[3]
Amyotrophic lateral sclerosis type 1	DIS5A2M0	Strong	Altered Expression	[4]
Analgesia	DISK3TVI	Strong	Biomarker	[5]
Anxiety	DISIJDBA	Strong	Biomarker	[6]
Anxiety disorder	DISBI2BT	Strong	Biomarker	[6]
Atopic dermatitis	DISTCP41	Strong	Genetic Variation	[7]
Atrial fibrillation	DIS15W6U	Strong	Altered Expression	[8]
Autosomal dominant optic atrophy, classic form	DISXUAV9	Strong	Biomarker	[9]
Autosomal dominant polycystic kidney disease	DISBHWUI	Strong	Genetic Variation	[10]
Breast cancer	DIS7DPX1	Strong	Altered Expression	[11]
Breast carcinoma	DIS2UE88	Strong	Altered Expression	[11]
Cardiac failure	DISDC067	Strong	Altered Expression	[12]
Cardiovascular disease	DIS2IQDX	Strong	Genetic Variation	[13]
Chikungunya virus infection	DISDXEHY	Strong	Biomarker	[14]
Congestive heart failure	DIS32MEA	Strong	Altered Expression	[12]
Coronary heart disease	DIS5OIP1	Strong	Biomarker	[15]
Depression	DIS3XJ69	Strong	Genetic Variation	[6]
Dilated cardiomyopathy 1A	DIS0RK9Z	Strong	Biomarker	[16]
Exocrine pancreatic insufficiency	DISCZYU2	Strong	Altered Expression	[17]
Knee osteoarthritis	DISLSNBJ	Strong	Biomarker	[18]
Non-alcoholic fatty liver disease	DISDG1NL	Strong	Biomarker	[19]
Oral lichen planus	DISVEAJA	Strong	Biomarker	[6]
Oropharyngeal squamous cell carcinoma	DIS7D7QV	Strong	Biomarker	[20]
Plasma cell myeloma	DIS0DFZ0	Strong	Biomarker	[21]
Prostate cancer	DISF190Y	Strong	Biomarker	[22]
Prostate neoplasm	DISHDKGQ	Strong	Altered Expression	[22]
Schizophrenia	DISSRV2N	Strong	Altered Expression	[23]
Systemic lupus erythematosus	DISI1SZ7	Strong	Genetic Variation	[24]
High blood pressure	DISY2OHH	moderate	Biomarker	[25]
Obesity	DIS47Y1K	moderate	Biomarker	[26]
Pancreatic cancer	DISJC981	moderate	Biomarker	[27]
Polycystic ovarian syndrome	DISZ2BNG	moderate	Biomarker	[28]
Prostate carcinoma	DISMJPLE	moderate	Biomarker	[22]
Advanced cancer	DISAT1Z9	Limited	Biomarker	[29]
Chronic pancreatitis	DISBUOMJ	Limited	Biomarker	[30]
Hepatocellular carcinoma	DIS0J828	Limited	Altered Expression	[31]
Neoplasm	DISZKGEW	Limited	Biomarker	[32]
Non-insulin dependent diabetes	DISK1O5Z	Limited	Biomarker	[33]
Severe acute respiratory syndrome (SARS)	DISYW14W	Limited	Biomarker	[34]
Spinocerebellar ataxia type 3	DISQBQID	Limited	Altered Expression	[35]
Type-1 diabetes	DIS7HLUB	Limited	Biomarker	[33]
Waldenstrom macroglobulinemia	DIS9O23I	Limited	Altered Expression	[36]
------------------------------------------------------------------------------------


⏷ Show the Full List of 44 Disease(s)

Molecular Interaction Atlas (MIA)

MIA Detail

Jump to Detail Molecular Interaction Atlas of This DOT

3 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Chymotrypsin-like protease CTRL-1 (CTRL).	[37]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Chymotrypsin-like protease CTRL-1 (CTRL).	[41]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the methylation of Chymotrypsin-like protease CTRL-1 (CTRL).	[44]
------------------------------------------------------------------------------------

7 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Quercetin	DM3NC4M	Approved	Quercetin increases the expression of Chymotrypsin-like protease CTRL-1 (CTRL).	[38]
Methotrexate	DM2TEOL	Approved	Methotrexate decreases the expression of Chymotrypsin-like protease CTRL-1 (CTRL).	[39]
Urethane	DM7NSI0	Phase 4	Urethane decreases the expression of Chymotrypsin-like protease CTRL-1 (CTRL).	[40]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of Chymotrypsin-like protease CTRL-1 (CTRL).	[42]
PMID28870136-Compound-48	DMPIM9L	Patented	PMID28870136-Compound-48 increases the expression of Chymotrypsin-like protease CTRL-1 (CTRL).	[43]
CH-223191	DMMJZYC	Investigative	CH-223191 decreases the expression of Chymotrypsin-like protease CTRL-1 (CTRL).	[45]
Plumbagin	DM9BS50	Investigative	Plumbagin decreases the activity of Chymotrypsin-like protease CTRL-1 (CTRL).	[46]
------------------------------------------------------------------------------------


⏷ Show the Full List of 7 Drug(s)

References

1	From the psychosis prodrome to the first-episode of psychosis: No evidence of a cognitive decline.J Psychiatr Res. 2018 Jan;96:231-238. doi: 10.1016/j.jpsychires.2017.10.014. Epub 2017 Oct 19.
2	Takotsubo syndrome and estrogen receptor genes: partners in crime?.J Cardiovasc Med (Hagerstown). 2017 Apr;18(4):268-276. doi: 10.2459/JCM.0000000000000500.
3	Analytical and clinical performances of the automated Lumipulse cerebrospinal fluid A(42) and T-Tau assays for Alzheimer's disease diagnosis.J Neurol. 2019 Sep;266(9):2304-2311. doi: 10.1007/s00415-019-09418-6. Epub 2019 Jun 10.
4	Proteasome inhibition enhances the stability of mouse Cu/Zn superoxide dismutase with mutations linked to familial amyotrophic lateral sclerosis.J Neurol Sci. 1996 Jul;139(1):15-20.
5	Dexmedetomidine in combination with morphine improves postoperative analgesia and sleep quality in elderly patients after open abdominal surgery: A pilot randomized control trial.PLoS One. 2018 Aug 14;13(8):e0202008. doi: 10.1371/journal.pone.0202008. eCollection 2018.
6	Evaluation of depression, anxiety and stress levels in patients with oral lichen planus.J Oral Sci. 2019 Aug 28;61(3):391-397. doi: 10.2334/josnusd.18-0113. Epub 2019 Jun 10.
7	No evidence for an association between a variant of the mast cell chymase gene and atopic dermatitis based on case-control and haplotype-relative-risk analyses.Hum Hered. 1998 Sep-Oct;48(5):271-4. doi: 10.1159/000022815.
8	Immunoproteasome Subunit 5i Promotes Ang II (Angiotensin II)-Induced Atrial Fibrillation by Targeting ATRAP (Ang II Type I Receptor-Associated Protein) Degradation in Mice.Hypertension. 2019 Jan;73(1):92-101. doi: 10.1161/HYPERTENSIONAHA.118.11813.
9	Facilitating physical activity and reducing symptoms in patients with knee osteoarthritis: study protocol of a randomized controlled trial to test a theory-based PrevOP-psychological adherence program (PrevOP-PAP).BMC Musculoskelet Disord. 2018 Jul 18;19(1):221. doi: 10.1186/s12891-018-2158-8.
10	Morphological evaluation of sympathetic renal innervation in patients with autosomal dominant polycystic kidney disease.J Nephrol. 2020 Feb;33(1):83-89. doi: 10.1007/s40620-019-00612-3. Epub 2019 Apr 25.
11	Proteasome inhibition represses ERalpha gene expression in ER+ cells: a new link between proteasome activity and estrogen signaling in breast cancer.Oncogene. 2010 Mar 11;29(10):1509-18. doi: 10.1038/onc.2009.434. Epub 2009 Nov 30.
12	Exercise training prevents oxidative stress and ubiquitin-proteasome system overactivity and reverse skeletal muscle atrophy in heart failure.PLoS One. 2012;7(8):e41701. doi: 10.1371/journal.pone.0041701. Epub 2012 Aug 3.
13	The Preterm Heart in Childhood: Left Ventricular Structure, Geometry, and Function Assessed by Echocardiography in 6-Year-Old Survivors of Periviable Births.J Am Heart Assoc. 2018 Jan 20;7(2):e007742. doi: 10.1161/JAHA.117.007742.
14	Structure-function insights into chikungunya virus capsid protein: Small molecules targeting capsid hydrophobic pocket.Virology. 2018 Feb;515:223-234. doi: 10.1016/j.virol.2017.12.020. Epub 2018 Jan 5.
15	Effects of 6 Months of Exercise-Based Cardiac Rehabilitation on Autonomic Function and Neuro-Cardiovascular Stress Reactivity in Coronary Artery Disease Patients.J Am Heart Assoc. 2019 Sep 3;8(17):e012257. doi: 10.1161/JAHA.119.012257. Epub 2019 Aug 23.
16	A Randomized Comparative Study on the Efficacy of Intracoronary Infusion of Autologous Bone Marrow Mononuclear Cells and Mesenchymal Stem Cells in Patients With Dilated Cardiomyopathy.Int Heart J. 2017 Apr 6;58(2):238-244. doi: 10.1536/ihj.16-328. Epub 2017 Feb 13.
17	Diagnostic Performance of Measurement of Fecal Elastase-1 in Detection of Exocrine Pancreatic Insufficiency: Systematic Review and Meta-analysis.Clin Gastroenterol Hepatol. 2018 Aug;16(8):1220-1228.e4. doi: 10.1016/j.cgh.2018.01.027. Epub 2018 Jan 31.
18	Knee Surgery Is Associated With Greater Odds of Knee Osteoarthritis Diagnosis.J Sport Rehabil. 2019 Sep 1;28(7):716-723. doi: 10.1123/jsr.2018-0077.
19	Serum coding and non-coding RNAs as biomarkers of NAFLD and fibrosis severity.Liver Int. 2019 Sep;39(9):1742-1754. doi: 10.1111/liv.14167. Epub 2019 Jun 26.
20	Treponema denticola chymotrypsin-like protease as associated with HPV-negative oropharyngeal squamous cell carcinoma.Br J Cancer. 2018 Jul;119(1):89-95. doi: 10.1038/s41416-018-0143-5. Epub 2018 Jun 22.
21	Non-covalent immunoproteasome inhibitors induce cell cycle arrest in multiple myeloma MM.1R cells.J Enzyme Inhib Med Chem. 2019 Dec;34(1):1307-1313. doi: 10.1080/14756366.2019.1594802.
22	Potential use of chymotrypsin-like proteasomal activity as a biomarker for prostate cancer.Oncol Lett. 2018 Apr;15(4):5149-5154. doi: 10.3892/ol.2018.7936. Epub 2018 Feb 2.
23	Intracellular compartment-specific proteasome dysfunction in postmortem cortex in schizophrenia subjects.Mol Psychiatry. 2020 Apr;25(4):776-790. doi: 10.1038/s41380-019-0359-7. Epub 2019 Jan 25.
24	Increased Insulin Resistance and Glucagon Levels in Mild/Inactive Systemic Lupus Erythematosus Patients Despite Normal Glucose Tolerance.Arthritis Care Res (Hoboken). 2018 Jan;70(1):114-124. doi: 10.1002/acr.23237. Epub 2017 Dec 6.
25	Optic Nerve Sheath Diameter Ultrasound Evaluation in Intensive Care Unit: Possible Role and Clinical Aspects in Neurological Critical Patients' Daily Monitoring.Biomed Res Int. 2017;2017:1621428. doi: 10.1155/2017/1621428. Epub 2017 Mar 21.
26	Metabolic and muscular factors limiting aerobic exercise in obese subjects.Eur J Appl Physiol. 2019 Aug;119(8):1779-1788. doi: 10.1007/s00421-019-04167-w. Epub 2019 Jun 11.
27	Integrated whole genome microarray analysis and immunohistochemical assay identifies COL11A1, GJB2 and CTRL as predictive biomarkers for pancreatic cancer.Cancer Cell Int. 2018 Nov 6;18:174. doi: 10.1186/s12935-018-0669-x. eCollection 2018.
28	Age at adiposity rebound in childhood is associated with PCOS diagnosis and obesity in adulthood-longitudinal analysis of BMI data from birth to age 46 in cases of PCOS.Int J Obes (Lond). 2019 Jul;43(7):1370-1379. doi: 10.1038/s41366-019-0318-z. Epub 2019 Feb 4.
29	Changes in taste and food preferences in breast cancer patients receiving chemotherapy: a pilot study.Support Care Cancer. 2020 Mar;28(3):1265-1275. doi: 10.1007/s00520-019-04924-9. Epub 2019 Jun 22.
30	Genetic Analysis of Human Chymotrypsin-Like Elastases 3A and 3B (CELA3A and CELA3B) to Assess the Role of Complex Formation between Proelastases and Procarboxypeptidases in Chronic Pancreatitis.Int J Mol Sci. 2016 Dec 20;17(12):2148. doi: 10.3390/ijms17122148.
31	Quercetin suppresses the chymotrypsin-like activity of proteasome via inhibition of MEK1/ERK1/2 signaling pathway in hepatocellular carcinoma HepG2 cells.Can J Physiol Pharmacol. 2018 May;96(5):521-526. doi: 10.1139/cjpp-2017-0655. Epub 2018 Feb 2.
32	Aquaporin-1 inhibition reduces metastatic formation in a mouse model of melanoma.J Cell Mol Med. 2018 Feb;22(2):904-912. doi: 10.1111/jcmm.13378. Epub 2017 Oct 17.
33	Polymorphism E23K (rs5219) in the KCNJ11 gene in Euro-Brazilian subjects with type 1 and 2 diabetes.Genet Mol Res. 2017 Apr 5;16(2). doi: 10.4238/gmr16029543.
34	Evaluation of a non-prime site substituent and warheads combined with a decahydroisoquinolin scaffold as a SARS 3CL protease inhibitor.Bioorg Med Chem. 2019 Jan 15;27(2):425-435. doi: 10.1016/j.bmc.2018.12.019. Epub 2018 Dec 12.
35	T1-11 and JMF1907 ameliorate polyglutamine-expanded ataxin-3-induced neurodegeneration, transcriptional dysregulation and ataxic symptom in the SCA3 transgenic mouse.Neuropharmacology. 2015 Dec;99:308-17. doi: 10.1016/j.neuropharm.2015.08.009. Epub 2015 Aug 6.
36	Selective inhibition of chymotrypsin-like activity of the immunoproteasome and constitutive proteasome in Waldenstrom macroglobulinemia.Blood. 2010 May 20;115(20):4051-60. doi: 10.1182/blood-2009-09-243402. Epub 2010 Jan 28.
37	Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
38	Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
39	Global molecular effects of tocilizumab therapy in rheumatoid arthritis synovium. Arthritis Rheumatol. 2014 Jan;66(1):15-23.
40	Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
41	Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
42	Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
43	Oxidative stress modulates theophylline effects on steroid responsiveness. Biochem Biophys Res Commun. 2008 Dec 19;377(3):797-802.
44	DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
45	Adaptive changes in global gene expression profile of lung carcinoma A549 cells acutely exposed to distinct types of AhR ligands. Toxicol Lett. 2018 Aug;292:162-174.
46	Plumbagin induces paraptosis in cancer cells by disrupting the sulfhydryl homeostasis and proteasomal function. Chem Biol Interact. 2019 Sep 1;310:108733. doi: 10.1016/j.cbi.2019.108733. Epub 2019 Jul 2.