Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTC1274J)

• DOT Name: Contactin-3 (CNTN3)
• Synonyms: Brain-derived immunoglobulin superfamily protein 1; BIG-1; Plasmacytoma-associated neuronal glycoprotein
• Gene Name: CNTN3
• Related Disease:
  Cone-rod dystrophy 2
  Glioblastoma multiforme
  Invasive breast carcinoma
  Abdominal aortic aneurysm
  Acute gouty arthritis
  Advanced cancer
  Allergic contact dermatitis
  Anxiety
  Anxiety disorder
  Arteriosclerosis
  Atherosclerosis
  Autism
  Breast cancer
  Breast carcinoma
  Breast neoplasm
  Catecholaminergic polymorphic ventricular tachycardia 1
  Colitis
  Cushing disease
  Depression
  Familial dilated cardiomyopathy
  Fibromyalgia
  Freeman-Sheldon syndrome
  High blood pressure
  Hypertrophic cardiomyopathy
  Long QT syndrome
  Major depressive disorder
  Malignant neoplasm
  Mixed anxiety and depressive disorder
  Mosaic variegated aneuploidy syndrome 1
  Neoplasm
  Nephropathy
  Peripheral arterial disease
  Pityriasis rubra pilaris
  Post-traumatic stress disorder
  Psoriasis
  Restless legs syndrome
  Trichohepatoenteric syndrome
  Obesity
  Keratoconjunctivitis sicca
  Neuralgia
• UniProt ID: CNTN3_HUMAN
• PDB ID: 1WJ3
• Pfam ID: PF00041 ; PF07679 ; PF13927
• Sequence:
  MMFPWKQLILLSFIGCLGGELLLQGPVFIKEPSNSIFPVGSEDKKITLHCEARGNPSPHY
  RWQLNGSDIDMSMEHRYKLNGGNLVVINPNRNWDTGTYQCFATNSLGTIVSREAKLQFAY
  LENFKTKMRSTVSVREGQGVVLLCGPPPHSGELSYAWIFNEYPSFVEEDSRRFVSQETGH
  LYISKVEPSDVGNYTCVVTSMVTNARVLGSPTPLVLRSDGVMGEYEPKIEVQFPETLPAA
  KGSTVKLECFALGNPIPQINWRRSDGLPFSSKIKLRKFSGVLEIPNFQQEDAGSYECIAE
  NSRGKNVARGRLTYYAKPHWVQLIKDVEIAVEDSLYWECRASGKPKPSYRWLKNGAALVL
  EERTQIENGALTISNLSVTDSGMFQCIAENKHGLVYSSAELKVVASAPDFSKNPMKKLVQ
  VQVGSLVSLDCKPRASPRALSSWKKGDVSVQEHERISLLNDGGLKIANVTKADAGTYTCM
  AENQFGKANGTTHLVVTEPTRITLAPSNMDVSVGESVILPCQVQHDPLLDIIFTWYFNGA
  LADFKKDGSHFEKVGGSSSGDLMIRNIQLKHSGKYVCMVQTGVDSVSSAADLIVRGSPGP
  PENVKVDEITDTTAQLSWKEGKDNHSPVISYSIQARTPFSVGWQTVTTVPEVIDGKTHTA
  TVVELNPWVEYEFRVVASNKIGGGEPSLPSEKVRTEEAVPEVPPSEVNGGGGSRSELVIT
  WDPVPEELQNGEGFGYVVAFRPLGVTTWIQTVVTSPDTPRYVFRNESIVPYSPYEVKVGV
  YNNKGEGPFSPVTTVFSAEEEPTVAPSQVSANSLSSSEIEVSWNTIPWKLSNGHLLGYEV
  RYWNGGGKEESSSKMKVAGNETSARLRGLKSNLAYYTAVRAYNSAGAGPFSATVNVTTKK
  TPPSQPPGNVVWNATDTKVLLNWEQVKAMENESEVTGYKVFYRTSSQNNVQVLNTNKTSA
  ELVLPIKEDYIIEVKATTDGGDGTSSEQIRIPRITSMDARGSTSAISNVHPMSSYMPIVL
  FLIVYVLW
• Function: Contactins mediate cell surface interactions during nervous system development. Has some neurite outgrowth-promoting activity.
• Tissue Specificity: In brain, it is expressed in frontal lobe, occipital lobe, cerebellum and amygdala.
• Reactome Pathway: Post-translational modification (R-HSA-163125)

Molecular Interaction Atlas (MIA) of This DOT

40 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Cone-rod dystrophy 2	DISX2RWY	Definitive	Biomarker	[1]
Glioblastoma multiforme	DISK8246	Definitive	Altered Expression	[2]
Invasive breast carcinoma	DISANYTW	Definitive	Biomarker	[3]
Abdominal aortic aneurysm	DISD06OF	Strong	Genetic Variation	[4]
Acute gouty arthritis	DISY5UJH	Strong	Biomarker	[5]
Advanced cancer	DISAT1Z9	Strong	Biomarker	[6]
Allergic contact dermatitis	DISFFVF9	Strong	Biomarker	[7]
Anxiety	DISIJDBA	Strong	Altered Expression	[8]
Anxiety disorder	DISBI2BT	Strong	Altered Expression	[8]
Arteriosclerosis	DISK5QGC	Strong	Biomarker	[9]
Atherosclerosis	DISMN9J3	Strong	Biomarker	[9]
Autism	DISV4V1Z	Strong	Biomarker	[10]
Breast cancer	DIS7DPX1	Strong	Biomarker	[11]
Breast carcinoma	DIS2UE88	Strong	Biomarker	[11]
Breast neoplasm	DISNGJLM	Strong	Genetic Variation	[12]
Catecholaminergic polymorphic ventricular tachycardia 1	DISKGB3F	Strong	Biomarker	[13]
Colitis	DISAF7DD	Strong	Biomarker	[14]
Cushing disease	DISOG6P2	Strong	Altered Expression	[15]
Depression	DIS3XJ69	Strong	Genetic Variation	[16]
Familial dilated cardiomyopathy	DISBHDU9	Strong	Biomarker	[13]
Fibromyalgia	DISZJDS2	Strong	Biomarker	[17]
Freeman-Sheldon syndrome	DIS7V9PS	Strong	Biomarker	[18]
High blood pressure	DISY2OHH	Strong	Genetic Variation	[9]
Hypertrophic cardiomyopathy	DISQG2AI	Strong	Biomarker	[13]
Long QT syndrome	DISMKWS3	Strong	Biomarker	[13]
Major depressive disorder	DIS4CL3X	Strong	Genetic Variation	[19]
Malignant neoplasm	DISS6SNG	Strong	Genetic Variation	[20]
Mixed anxiety and depressive disorder	DISV809X	Strong	Genetic Variation	[21]
Mosaic variegated aneuploidy syndrome 1	DISOV0CG	Strong	Biomarker	[22]
Neoplasm	DISZKGEW	Strong	Genetic Variation	[23]
Nephropathy	DISXWP4P	Strong	Genetic Variation	[24]
Peripheral arterial disease	DIS78WFB	Strong	Genetic Variation	[25]
Pityriasis rubra pilaris	DISVC72D	Strong	Biomarker	[26]
Post-traumatic stress disorder	DISHL1EY	Strong	Biomarker	[27]
Psoriasis	DIS59VMN	Strong	Biomarker	[28]
Restless legs syndrome	DISNWY00	Strong	Biomarker	[29]
Trichohepatoenteric syndrome	DISL3ODF	Strong	Biomarker	[30]
Obesity	DIS47Y1K	moderate	Biomarker	[8]
Keratoconjunctivitis sicca	DISNOENH	Limited	Biomarker	[31]
Neuralgia	DISWO58J	Limited	Biomarker	[31]

8 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Contactin-3 (CNTN3).	[32]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Contactin-3 (CNTN3).	[33]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide decreases the expression of Contactin-3 (CNTN3).	[34]
Triclosan	DMZUR4N	Approved	Triclosan decreases the expression of Contactin-3 (CNTN3).	[35]
Progesterone	DMUY35B	Approved	Progesterone increases the expression of Contactin-3 (CNTN3).	[36]
Clorgyline	DMCEUJD	Approved	Clorgyline increases the expression of Contactin-3 (CNTN3).	[37]
Belinostat	DM6OC53	Phase 2	Belinostat decreases the expression of Contactin-3 (CNTN3).	[38]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A increases the expression of Contactin-3 (CNTN3).	[39]

References

• [1] Posterior cord syndrome: Demographics and rehabilitation outcomes.J Spinal Cord Med. 2021 Mar;44(2):241-246. doi: 10.1080/10790268.2019.1585135. Epub 2019 Apr 2.
• [2] Prognostic significance of contactin 3 expression and associated genes in glioblastoma multiforme.Oncol Lett. 2019 Aug;18(2):1863-1871. doi: 10.3892/ol.2019.10482. Epub 2019 Jun 14.
• [3] Cholesterol, Cholesterol-Lowering Medication Use, and Breast Cancer Outcome in the BIG 1-98 Study.J Clin Oncol. 2017 Apr 10;35(11):1179-1188. doi: 10.1200/JCO.2016.70.3116. Epub 2017 Feb 13.
• [4] Identification of a genetic variant associated with abdominal aortic aneurysms on chromosome 3p12.3 by genome wide association.J Vasc Surg. 2009 Jun;49(6):1525-31. doi: 10.1016/j.jvs.2009.01.041.
• [5] Enthesitis and its relationship with disease activity, functional status, and quality of life in psoriatic arthritis: a multi-center study.Rheumatol Int. 2020 Feb;40(2):283-294. doi: 10.1007/s00296-019-04480-9. Epub 2019 Nov 26.
• [6] Infertility and Health-Related Quality of Life in United States Women Veterans.J Womens Health (Larchmt). 2020 Mar;29(3):412-419. doi: 10.1089/jwh.2019.7798. Epub 2019 Nov 22.
• [7] Gene expression time course in the human skin during elicitation of allergic contact dermatitis.J Invest Dermatol. 2007 Nov;127(11):2585-95. doi: 10.1038/sj.jid.5700902. Epub 2007 Jun 28.
• [8] Psychosocial and Cardiometabolic Health of Patients With Differing Body Mass Index Completing Cardiac Rehabilitation.Can J Cardiol. 2019 Jun;35(6):712-720. doi: 10.1016/j.cjca.2019.02.024. Epub 2019 Mar 6.
• [9] Risk factors between intracranial-extracranial atherosclerosis and anterior-posterior circulation stroke in ischaemic stroke.Neurol Res. 2017 Jan;39(1):30-35. doi: 10.1080/01616412.2016.1250856. Epub 2016 Oct 31.
• [10] Identifying autism loci and genes by tracing recent shared ancestry.Science. 2008 Jul 11;321(5886):218-23. doi: 10.1126/science.1157657.
• [11] Pregnancies during and after trastuzumab and/or lapatinib in patients with human epidermal growth factor receptor 2-positive early breast cancer: Analysis from the NeoALTTO (BIG 1-06) and ALTTO (BIG 2-06) trials.Cancer. 2019 Jan 15;125(2):307-316. doi: 10.1002/cncr.31784. Epub 2018 Oct 18.
• [12] Validation of a yeast functional assay for p53 mutations using clonal sequencing.J Pathol. 2013 Dec;231(4):441-8. doi: 10.1002/path.4243.
• [13] Health status of cardiac genetic disease patients and their at-risk relatives.Int J Cardiol. 2013 May 25;165(3):448-53. doi: 10.1016/j.ijcard.2011.08.083. Epub 2011 Sep 17.
• [14] Anti-Inflammatory and Anti-Oxidant Effects of p-Chloro-phenyl-selenoesterol on TNBS-Induced Inflammatory Bowel Disease in Mice.J Cell Biochem. 2017 Apr;118(4):709-717. doi: 10.1002/jcb.25670. Epub 2016 Dec 29.
• [15] Quality of life is significantly impaired in both secretory and non-functioning pituitary adenomas.Clin Endocrinol (Oxf). 2019 Mar;90(3):457-467. doi: 10.1111/cen.13915. Epub 2019 Jan 15.
• [16] Are Outcomes of Anterior Cervical Discectomy and Fusion Influenced by Presurgical Depression Symptoms on the Mental Component Score of the Short Form-12 Survey?.Spine (Phila Pa 1976). 2020 Feb 1;45(3):201-207. doi: 10.1097/BRS.0000000000003231.
• [17] Extra Virgin Olive Oil Improves Oxidative Stress, Functional Capacity, and Health-Related Psychological Status in Patients With Fibromyalgia: A Preliminary Study.Biol Res Nurs. 2017 Jan;19(1):106-115. doi: 10.1177/1099800416659370. Epub 2016 Jul 26.
• [18] Home-Based Exercise Enhances Health-Related Quality of Life in Persons With Spinal Cord Injury: ARandomized Controlled Trial.Arch Phys Med Rehabil. 2018 Oct;99(10):1998-2006.e1. doi: 10.1016/j.apmr.2018.05.008. Epub 2018 Jun 11.
• [19] Impact of pre-diagnosis depressive symptoms and health-related quality of life on treatment choice for ductal carcinoma in situ and stage I breast cancer in older women.Breast Cancer Res Treat. 2019 Feb;173(3):709-717. doi: 10.1007/s10549-018-5006-5. Epub 2018 Nov 8.
• [20] Insufficiency of BUBR1, a mitotic spindle checkpoint regulator, causes impaired ciliogenesis in vertebrates.Hum Mol Genet. 2011 May 15;20(10):2058-70. doi: 10.1093/hmg/ddr090. Epub 2011 Mar 9.
• [21] The influence of selected psychological variables on quality of life of chronically dialysed patients.Scand J Caring Sci. 2019 Dec;33(4):840-847. doi: 10.1111/scs.12680. Epub 2019 May 9.
• [22] Prenatal diagnosis of premature chromatid separation/mosaic variegated aneuploidy (PCS/MVA) syndrome.J Obstet Gynaecol Res. 2018 Jul;44(7):1313-1317. doi: 10.1111/jog.13647. Epub 2018 Apr 19.
• [23] Integrated Classification of Prostate Cancer Reveals a Novel Luminal Subtype with Poor Outcome.Cancer Res. 2016 Sep 1;76(17):4948-58. doi: 10.1158/0008-5472.CAN-16-0902. Epub 2016 Jun 14.
• [24] Gender differences and burden of chronic conditions: impact on quality of life among the elderly in Taiwan.Aging Clin Exp Res. 2019 Nov;31(11):1625-1633. doi: 10.1007/s40520-018-1099-2. Epub 2019 Jan 2.
• [25] Genetic Variants in the Bone Morphogenic Protein Gene Family Modify the Association between Residential Exposure to Traffic and Peripheral Arterial Disease.PLoS One. 2016 Apr 15;11(4):e0152670. doi: 10.1371/journal.pone.0152670. eCollection 2016.
• [26] Comparison of mental and physical health between patients with primary and secondary Raynaud's phenomenon Category: Article.J Psychosom Res. 2019 Jan;116:6-9. doi: 10.1016/j.jpsychores.2018.11.001. Epub 2018 Nov 5.
• [27] An Assessment of Long-Term Physical and Emotional Quality of Life of Persons Injured on 9/11/2001.Int J Environ Res Public Health. 2019 Mar 23;16(6):1054. doi: 10.3390/ijerph16061054.
• [28] Treatment modifying factors of biologics for psoriatic arthritis: a systematic review and Bayesian meta-regression.Clin Exp Rheumatol. 2017 Jul-Aug;35(4):681-688. Epub 2017 Jan 15.
• [29] Restless legs syndrome is associated with major comorbidities in a population of Danish blood donors.Sleep Med. 2018 May;45:124-131. doi: 10.1016/j.sleep.2018.02.007. Epub 2018 Mar 8.
• [30] TALEN-mediated single-base-pair editing identification of an intergenic mutation upstream of BUB1B as causative of PCS (MVA) syndrome.Proc Natl Acad Sci U S A. 2014 Jan 28;111(4):1461-6. doi: 10.1073/pnas.1317008111. Epub 2013 Dec 16.
• [31] Dysfunctional Coping Mechanisms Contribute to Dry Eye Symptoms.J Clin Med. 2019 Jun 24;8(6):901. doi: 10.3390/jcm8060901.
• [32] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [33] Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
• [34] Identification of transcriptome signatures and biomarkers specific for potential developmental toxicants inhibiting human neural crest cell migration. Arch Toxicol. 2016 Jan;90(1):159-80.
• [35] Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
• [36] Effects of progesterone treatment on expression of genes involved in uterine quiescence. Reprod Sci. 2011 Aug;18(8):781-97.
• [37] Anti-oncogenic and pro-differentiation effects of clorgyline, a monoamine oxidase A inhibitor, on high grade prostate cancer cells. BMC Med Genomics. 2009 Aug 20;2:55. doi: 10.1186/1755-8794-2-55.
• [38] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [39] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.