Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTDJ3OSV)

• DOT Name: AH receptor-interacting protein (AIP)
• Synonyms: AIP; Aryl-hydrocarbon receptor-interacting protein; HBV X-associated protein 2; XAP-2; Immunophilin homolog ARA9
• Gene Name: AIP
• Related Disease:
  Acromegaly
  Acute intermittent hepatic porphyria
  Adenoma
  Adrenal adenoma
  Adrenal cortex neoplasm
  Adrenocortical carcinoma
  B-cell lymphoma
  Cardiovascular disease
  Carney complex
  Cushing disease
  Gastrointestinal stromal tumour
  Growth hormone secreting pituitary adenoma 1
  Growth hormone-producing pituitary gland adenoma
  Hepatitis B virus infection
  Hepatocellular carcinoma
  Hereditary nonpolyposis colon cancer
  Lymphoma
  Lynch syndrome
  McCune-Albright syndrome
  Multiple endocrine neoplasia
  Multiple intestinal atresia
  Paraganglioma
  Pheochromocytoma
  Pituitary adenoma
  Pituitary tumor
  Primary hyperparathyroidism
  Prostate carcinoma
  Meningioma
  Obstructive jaundice
  Familial isolated pituitary adenoma
  Pituitary gigantism
  Adrenal gland neoplasm
  Arrhythmia
  Chronic pancreatitis
  Colorectal carcinoma
  GNE myopathy
  Nematode infection
  Pancreatic cancer
  Pituitary gland disorder
  Prostate cancer
• UniProt ID: AIP_HUMAN
• PDB ID: 2LKN; 4AIF; 4APO; 7ZUB
• Pfam ID: PF00254
• Sequence:
  MADIIARLREDGIQKRVIQEGRGELPDFQDGTKATFHYRTLHSDDEGTVLDDSRARGKPM
  ELIIGKKFKLPVWETIVCTMREGEIAQFLCDIKHVVLYPLVAKSLRNIAVGKDPLEGQRH
  CCGVAQMREHSSLGHADLDALQQNPQPLIFHMEMLKVESPGTYQQDPWAMTDEEKAKAVP
  LIHQEGNRLYREGHVKEAAAKYYDAIACLKNLQMKEQPGSPEWIQLDQQITPLLLNYCQC
  KLVVEEYYEVLDHCSSILNKYDDNVKAYFKRGKAHAAVWNAQEAQADFAKVLELDPALAP
  VVSRELRALEARIRQKDEEDKARFRGIFSH
• Function: May play a positive role in AHR-mediated (aromatic hydrocarbon receptor) signaling, possibly by influencing its receptivity for ligand and/or its nuclear targeting.; Cellular negative regulator of the hepatitis B virus (HBV) X protein.
• Tissue Specificity: Widely expressed. Higher levels seen in the heart, placenta and skeletal muscle. Not expressed in the liver.
• KEGG Pathway:
  Cushing syndrome (hsa04934)
  Chemical carcinogenesis - receptor activation (hsa05207)
• Reactome Pathway:
  Gene and protein expression by JAK-STAT signaling after Interleukin-12 stimulation (R-HSA-8950505)
  Aryl hydrocarbon receptor signalling (R-HSA-8937144)

Molecular Interaction Atlas (MIA) of This DOT

40 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Acromegaly	DISCC73U	Definitive	Altered Expression	[1]
Acute intermittent hepatic porphyria	DIS80J7E	Strong	Biomarker	[2]
Adenoma	DIS78ZEV	Strong	Genetic Variation	[3]
Adrenal adenoma	DISC2UN8	Strong	Genetic Variation	[4]
Adrenal cortex neoplasm	DISO17X1	Strong	Altered Expression	[5]
Adrenocortical carcinoma	DISZF4HX	Strong	Biomarker	[6]
B-cell lymphoma	DISIH1YQ	Strong	Altered Expression	[7]
Cardiovascular disease	DIS2IQDX	Strong	Biomarker	[8]
Carney complex	DISVL3IP	Strong	Genetic Variation	[9]
Cushing disease	DISOG6P2	Strong	Genetic Variation	[10]
Gastrointestinal stromal tumour	DIS6TJYS	Strong	Genetic Variation	[4]
Growth hormone secreting pituitary adenoma 1	DISE8ZV7	Strong	Autosomal dominant	[11]
Growth hormone-producing pituitary gland adenoma	DIS45N3K	Strong	Altered Expression	[12]
Hepatitis B virus infection	DISLQ2XY	Strong	Biomarker	[13]
Hepatocellular carcinoma	DIS0J828	Strong	Biomarker	[14]
Hereditary nonpolyposis colon cancer	DISPA49R	Strong	Genetic Variation	[15]
Lymphoma	DISN6V4S	Strong	Altered Expression	[7]
Lynch syndrome	DIS3IW5F	Strong	Genetic Variation	[15]
McCune-Albright syndrome	DISCO2QT	Strong	Genetic Variation	[16]
Multiple endocrine neoplasia	DISZGBKW	Strong	Genetic Variation	[17]
Multiple intestinal atresia	DISNUH76	Strong	Genetic Variation	[18]
Paraganglioma	DIS2XXH5	Strong	Genetic Variation	[4]
Pheochromocytoma	DIS56IFV	Strong	Genetic Variation	[4]
Pituitary adenoma	DISJ5R1X	Strong	Genetic Variation	[19]
Pituitary tumor	DISN67JD	Strong	Genetic Variation	[20]
Primary hyperparathyroidism	DISB4U1Q	Strong	Biomarker	[21]
Prostate carcinoma	DISMJPLE	Strong	Biomarker	[22]
Meningioma	DISPT4TG	moderate	Genetic Variation	[23]
Obstructive jaundice	DIS2FDOT	moderate	Biomarker	[24]
Familial isolated pituitary adenoma	DISNEVYF	Supportive	Autosomal dominant	[11]
Pituitary gigantism	DISIUHNT	Supportive	Autosomal dominant	[25]
Adrenal gland neoplasm	DISFK7RF	Limited	Biomarker	[6]
Arrhythmia	DISFF2NI	Limited	Biomarker	[26]
Chronic pancreatitis	DISBUOMJ	Limited	Biomarker	[27]
Colorectal carcinoma	DIS5PYL0	Limited	Genetic Variation	[28]
GNE myopathy	DIS73X4W	Limited	Biomarker	[29]
Nematode infection	DISVFLRK	Limited	Biomarker	[30]
Pancreatic cancer	DISJC981	Limited	Biomarker	[31]
Pituitary gland disorder	DIS7XB48	Limited	Genetic Variation	[32]
Prostate cancer	DISF190Y	Limited	Biomarker	[22]

3 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of AH receptor-interacting protein (AIP).	[33]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of AH receptor-interacting protein (AIP).	[42]
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 decreases the phosphorylation of AH receptor-interacting protein (AIP).	[44]

15 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of AH receptor-interacting protein (AIP).	[34]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of AH receptor-interacting protein (AIP).	[35]
Doxorubicin	DMVP5YE	Approved	Doxorubicin increases the expression of AH receptor-interacting protein (AIP).	[36]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of AH receptor-interacting protein (AIP).	[37]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of AH receptor-interacting protein (AIP).	[38]
Temozolomide	DMKECZD	Approved	Temozolomide decreases the expression of AH receptor-interacting protein (AIP).	[39]
Methotrexate	DM2TEOL	Approved	Methotrexate increases the expression of AH receptor-interacting protein (AIP).	[40]
Selenium	DM25CGV	Approved	Selenium increases the expression of AH receptor-interacting protein (AIP).	[41]
Isotretinoin	DM4QTBN	Approved	Isotretinoin decreases the expression of AH receptor-interacting protein (AIP).	[35]
Alitretinoin	DMME8LH	Approved	Alitretinoin decreases the expression of AH receptor-interacting protein (AIP).	[35]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of AH receptor-interacting protein (AIP).	[43]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A affects the expression of AH receptor-interacting protein (AIP).	[45]
Milchsaure	DM462BT	Investigative	Milchsaure decreases the expression of AH receptor-interacting protein (AIP).	[46]
[3H]methyltrienolone	DMTSGOW	Investigative	[3H]methyltrienolone decreases the expression of AH receptor-interacting protein (AIP).	[47]
all-trans-4-oxo-retinoic acid	DMM2R1N	Investigative	all-trans-4-oxo-retinoic acid decreases the expression of AH receptor-interacting protein (AIP).	[35]

References

• [1] Circulating aryl hydrocarbon receptor-interacting protein (AIP) is independent of GH secretion.Endocr Connect. 2019 Apr;8(4):326-337. doi: 10.1530/EC-19-0082.
• [2] AIP and MEN1 mutations and AIP immunohistochemistry in pituitary adenomas in a tertiary referral center.Endocr Connect. 2019 Apr;8(4):338-348. doi: 10.1530/EC-19-0027.
• [3] Phosphodiesterases and cAMP Pathway in Pituitary Diseases.Front Endocrinol (Lausanne). 2019 Mar 19;10:141. doi: 10.3389/fendo.2019.00141. eCollection 2019.
• [4] Multiple endocrine neoplasias: advances and challenges for the future.J Intern Med. 2009 Jul;266(1):1-4. doi: 10.1111/j.1365-2796.2009.02108.x.
• [5] Isolated familial somatotropinoma: 11q13-loh and gene/protein expression analysis suggests a possible involvement of aip also in non-pituitary tumorigenesis.Clinics (Sao Paulo). 2010 Apr;65(4):407-15. doi: 10.1590/S1807-59322010000400010.
• [6] PURE ANDROGEN-PRODUCING ADRENAL TUMOR: CLINICAL FEATURES AND PATHOGENESIS.Endocr Pract. 2017 Apr 2;23(4):399-407. doi: 10.4158/EP161580.OR. Epub 2017 Jan 17.
• [7] Aryl Hydrocarbon Receptor Interacting Protein Maintains Germinal Center B Cells through Suppression of BCL6 Degradation.Cell Rep. 2019 Apr 30;27(5):1461-1471.e4. doi: 10.1016/j.celrep.2019.04.014.
• [8] Atherogenic impact of lecithin-cholesterol acyltransferase and its relation to cholesterol esterification rate in HDL (FER(HDL)) and AIP [log(TG/HDL-C)] biomarkers: the butterfly effect?.Physiol Res. 2017 May 4;66(2):193-203. doi: 10.33549/physiolres.933621.
• [9] Growth hormone-producing pituitary adenomas in childhood and young adulthood: clinical features and outcomes.Pituitary. 2018 Feb;21(1):1-9. doi: 10.1007/s11102-017-0836-4.
• [10] Germline AIP mutations in apparently sporadic pituitary adenomas: prevalence in a prospective single-center cohort of 443 patients.J Clin Endocrinol Metab. 2012 Apr;97(4):E663-70. doi: 10.1210/jc.2011-2291. Epub 2012 Feb 8.
• [11] AIP Familial Isolated Pituitary Adenomas. 2012 Jun 21 [updated 2020 Apr 16]. In: Adam MP, Feldman J, Mirzaa GM, Pagon RA, Wallace SE, Bean LJH, Gripp KW, Amemiya A, editors. GeneReviews(?) [Internet]. Seattle (WA): University of Washington, Seattle; 1993C2024.
• [12] AIP and the somatostatin system in pituitary tumours.J Endocrinol. 2017 Dec;235(3):R101-R116. doi: 10.1530/JOE-17-0254. Epub 2017 Aug 23.
• [13] XAP2, a novel hepatitis B virus X-associated protein that inhibits X transactivation.Nucleic Acids Res. 1996 Dec 1;24(23):4741-50. doi: 10.1093/nar/24.23.4741.
• [14] Screening for hepatocellular carcinoma in acute intermittent porphyria: a 15-year follow-up in northern Sweden.J Intern Med. 2011 May;269(5):538-45. doi: 10.1111/j.1365-2796.2010.02335.x. Epub 2010 Dec 28.
• [15] Molecular diagnosis of pituitary adenoma predisposition caused by aryl hydrocarbon receptor-interacting protein gene mutations.Proc Natl Acad Sci U S A. 2007 Mar 6;104(10):4101-5. doi: 10.1073/pnas.0700004104. Epub 2007 Feb 28.
• [16] Sporadic and genetic forms of paediatric somatotropinoma: a retrospective analysis of seven cases and a review of the literature.Orphanet J Rare Dis. 2011 Oct 24;6:67. doi: 10.1186/1750-1172-6-67.
• [17] Prevalence of AIP mutations in a large series of sporadic Italian acromegalic patients and evaluation of CDKN1B status in acromegalic patients with multiple endocrine neoplasia.Eur J Endocrinol. 2010 Sep;163(3):369-76. doi: 10.1530/EJE-10-0327. Epub 2010 Jun 7.
• [18] Should aip gene screening be recommended in family members of FIPA patients with R16H variant?.Pituitary. 2013 Jun;16(2):238-44. doi: 10.1007/s11102-012-0409-5.
• [19] Three Novel MEN1 Variants in AIP-Negative Familial Isolated Pituitary Adenoma Patients.Pathobiology. 2019;86(2-3):128-134. doi: 10.1159/000495252. Epub 2019 Jan 10.
• [20] AIP limits neurotransmitter release by inhibiting calcium bursts from the ryanodine receptor.Nat Commun. 2017 Nov 9;8(1):1380. doi: 10.1038/s41467-017-01704-z.
• [21] Mutation analysis of MEN1, HRPT2, CASR, CDKN1B, and AIP genes in primary hyperparathyroidism patients with features of genetic predisposition.J Endocrinol Invest. 2009 Jun;32(6):512-8. doi: 10.1007/BF03346498. Epub 2009 Mar 26.
• [22] Phenotype-specific CpG island methylation events in a murine model of prostate cancer.Cancer Res. 2008 Jun 1;68(11):4173-82. doi: 10.1158/0008-5472.CAN-07-6715.
• [23] Genetic analysis in a patient presenting with meningioma and familial isolated pituitary adenoma (FIPA) reveals selective involvement of the R81X mutation of the AIP gene in the pathogenesis of the pituitary tumor.Pituitary. 2012 Dec;15 Suppl 1:S61-7. doi: 10.1007/s11102-012-0391-y.
• [24] Autoimmune Pancreatitis.Am J Gastroenterol. 2018 Sep;113(9):1301. doi: 10.1038/s41395-018-0146-0. Epub 2018 Jun 18.
• [25] Clinical and genetic characterization of pituitary gigantism: an international collaborative study in 208 patients. Endocr Relat Cancer. 2015 Oct;22(5):745-57. doi: 10.1530/ERC-15-0320. Epub 2015 Jul 17.
• [26] Gene Therapy for Catecholaminergic Polymorphic Ventricular Tachycardia by Inhibition of Ca(2+)/Calmodulin-Dependent Kinase II.Circulation. 2019 Jul 30;140(5):405-419. doi: 10.1161/CIRCULATIONAHA.118.038514. Epub 2019 Jun 3.
• [27] The Propagation Display Method Improves the Reproducibility of Pancreatic Shear Wave Elastography.Ultrasound Med Biol. 2019 Aug;45(8):2242-2247. doi: 10.1016/j.ultrasmedbio.2019.04.003. Epub 2019 May 16.
• [28] Mutation analysis of aryl hydrocarbon receptor interacting protein (AIP) gene in colorectal, breast, and prostate cancers.Br J Cancer. 2007 Jan 29;96(2):352-6. doi: 10.1038/sj.bjc.6603573.
• [29] The novel CaMKII inhibitor GS-680 reduces diastolic SR Ca leak and prevents CaMKII-dependent pro-arrhythmic activity.J Mol Cell Cardiol. 2018 May;118:159-168. doi: 10.1016/j.yjmcc.2018.03.020. Epub 2018 Mar 31.
• [30] Purification and cloning of an apoptosis-inducing protein derived from fish infected with Anisakis simplex, a causative nematode of human anisakiasis.J Immunol. 2000 Aug 1;165(3):1491-7. doi: 10.4049/jimmunol.165.3.1491.
• [31] Contrast-Enhanced Endoscopic Ultrasound for Differentially Diagnosing Autoimmune Pancreatitis and Pancreatic Cancer.Gut Liver. 2018 Sep 15;12(5):591-596. doi: 10.5009/gnl17391.
• [32] Genetic analysis in young patients with sporadic pituitary macroadenomas: besides AIP don't forget MEN1 genetic analysis.Eur J Endocrinol. 2013 Mar 15;168(4):533-41. doi: 10.1530/EJE-12-0763. Print 2013 Apr.
• [33] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [34] Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
• [35] Retinoic acid and its 4-oxo metabolites are functionally active in human skin cells in vitro. J Invest Dermatol. 2005 Jul;125(1):143-53.
• [36] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [37] 17-Estradiol Activates HSF1 via MAPK Signaling in ER-Positive Breast Cancer Cells. Cancers (Basel). 2019 Oct 11;11(10):1533. doi: 10.3390/cancers11101533.
• [38] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [39] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [40] The contribution of methotrexate exposure and host factors on transcriptional variance in human liver. Toxicol Sci. 2007 Jun;97(2):582-94.
• [41] Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
• [42] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [43] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [44] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [45] A trichostatin A expression signature identified by TempO-Seq targeted whole transcriptome profiling. PLoS One. 2017 May 25;12(5):e0178302. doi: 10.1371/journal.pone.0178302. eCollection 2017.
• [46] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
• [47] Evaluation of an in vitro model of androgen ablation and identification of the androgen responsive proteome in LNCaP cells. Proteomics. 2007 Jan;7(1):47-63.