Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTFME7HT)

• DOT Name: Laminin subunit alpha-3 (LAMA3)
• Synonyms: Epiligrin 170 kDa subunit; E170; Epiligrin subunit alpha; Kalinin subunit alpha; Laminin-5 subunit alpha; Laminin-6 subunit alpha; Laminin-7 subunit alpha; Nicein subunit alpha
• Gene Name: LAMA3
• Related Disease:
  Adenocarcinoma
  Chronic kidney disease
  Junctional epidermolysis bullosa
  Amelogenesis imperfecta type 1
  Amyotrophic lateral sclerosis
  Breast cancer
  Breast neoplasm
  Cataract
  Colorectal carcinoma
  Dermatitis
  Early-onset posterior polar cataract
  Epidermolysis bullosa
  Epithelial ovarian cancer
  Glioblastoma multiforme
  Head-neck squamous cell carcinoma
  Junctional epidermolysis bullosa Herlitz type
  Junctional epidermolysis bullosa, non-Herlitz type
  Laryngo-onycho-cutaneous syndrome
  Lung adenocarcinoma
  Matthew-Wood syndrome
  Myocardial infarction
  Nail disorder
  Neoplasm
  Ovarian cancer
  Ovarian neoplasm
  Prion disease
  Prostate cancer
  Skin disease
  Age-related macular degeneration
  Allergic rhinitis
  Generalized junctional epidermolysis bullosa non-Herlitz type
  Adenoma
  Rheumatoid arthritis
  Cervical Intraepithelial neoplasia
  Ovarian serous adenocarcinoma
• UniProt ID: LAMA3_HUMAN
• Pfam ID: PF00052 ; PF00053 ; PF02210 ; PF06008 ; PF06009 ; PF00055
• Sequence:
  MAAAARPRGRALGPVLPPTPLLLLVLRVLPACGATARDPGAAAGLSLHPTYFNLAEAARI
  WATATCGERGPGEGRPQPELYCKLVGGPTAPGSGHTIQGQFCDYCNSEDPRKAHPVTNAI
  DGSERWWQSPPLSSGTQYNRVNLTLDLGQLFHVAYILIKFANSPRPDLWVLERSVDFGST
  YSPWQYFAHSKVDCLKEFGREANMAVTRDDDVLCVTEYSRIVPLENGEVVVSLINGRPGA
  KNFTFSHTLREFTKATNIRLRFLRTNTLLGHLISKAQRDPTVTRRYYYSIKDISIGGQCV
  CNGHAEVCNINNPEKLFRCECQHHTCGETCDRCCTGYNQRRWRPAAWEQSHECEACNCHG
  HASNCYYDPDVERQQASLNTQGIYAGGGVCINCQHNTAGVNCEQCAKGYYRPYGVPVDAP
  DGCIPCSCDPEHADGCEQGSGRCHCKPNFHGDNCEKCAIGYYNFPFCLRIPIFPVSTPSS
  EDPVAGDIKGCDCNLEGVLPEICDAHGRCLCRPGVEGPRCDTCRSGFYSFPICQACWCSA
  LGSYQMPCSSVTGQCECRPGVTGQRCDRCLSGAYDFPHCQGSSSACDPAGTINSNLGYCQ
  CKLHVEGPTCSRCKLLYWNLDKENPSGCSECKCHKAGTVSGTGECRQGDGDCHCKSHVGG
  DSCDTCEDGYFALEKSNYFGCQGCQCDIGGALSSMCSGPSGVCQCREHVVGKVCQRPENN
  YYFPDLHHMKYEIEDGSTPNGRDLRFGFDPLAFPEFSWRGYAQMTSVQNDVRITLNVGKS
  SGSLFRVILRYVNPGTEAVSGHITIYPSWGAAQSKEIIFLPSKEPAFVTVPGNGFADPFS
  ITPGIWVACIKAEGVLLDYLVLLPRDYYEASVLQLPVTEPCAYAGPPQENCLLYQHLPVT
  RFPCTLACEARHFLLDGEPRPVAVRQPTPAHPVMVDLSGREVELHLRLRIPQVGHYVVVV
  EYSTEAAQLFVVDVNVKSSGSVLAGQVNIYSCNYSVLCRSAVIDHMSRIAMYELLADADI
  QLKGHMARFLLHQVCIIPIEEFSAEYVRPQVHCIASYGRFVNQSATCVSLAHETPPTALI
  LDVLSGRPFPHLPQQSSPSVDVLPGVTLKAPQNQVTLRGRVPHLGRYVFVIHFYQAAHPT
  FPAQVSVDGGWPRAGSFHASFCPHVLGCRDQVIAEGQIEFDISEPEVAATVKVPEGKSLV
  LVRVLVVPAENYDYQILHKKSMDKSLEFITNCGKNSFYLDPQTASRFCKNSARSLVAFYH
  KGALPCECHPTGATGPHCSPEGGQCPCQPNVIGRQCTRCATGHYGFPRCKPCSCGRRLCE
  EMTGQCRCPPRTVRPQCEVCETHSFSFHPMAGCEGCNCSRRGTIEAAMPECDRDSGQCRC
  KPRITGRQCDRCASGFYRFPECVPCNCNRDGTEPGVCDPGTGACLCKENVEGTECNVCRE
  GSFHLDPANLKGCTSCFCFGVNNQCHSSHKRRTKFVDMLGWHLETADRVDIPVSFNPGSN
  SMVADLQELPATIHSASWVAPTSYLGDKVSSYGGYLTYQAKSFGLPGDMVLLEKKPDVQL
  TGQHMSIIYEETNTPRPDRLHHGRVHVVEGNFRHASSRAPVSREELMTVLSRLADVRIQG
  LYFTETQRLTLSEVGLEEASDTGSGRIALAVEICACPPAYAGDSCQGCSPGYYRDHKGLY
  TGRCVPCNCNGHSNQCQDGSGICVNCQHNTAGEHCERCQEGYYGNAVHGSCRACPCPHTN
  SFATGCVVNGGDVRCSCKAGYTGTQCERCAPGYFGNPQKFGGSCQPCSCNSNGQLGSCHP
  LTGDCINQEPKDSSPAEECDDCDSCVMTLLNDLATMGEQLRLVKSQLQGLSASAGLLEQM
  RHMETQAKDLRNQLLNYRSAISNHGSKIEGLERELTDLNQEFETLQEKAQVNSRKAQTLN
  NNVNRATQSAKELDVKIKNVIRNVHILLKQISGTDGEGNNVPSGDFSREWAEAQRMMREL
  RNRNFGKHLREAEADKRESQLLLNRIRTWQKTHQGENNGLANSIRDSLNEYEAKLSDLRA
  RLQEAAAQAKQANGLNQENERALGAIQRQVKEINSLQSDFTKYLTTADSSLLQTNIALQL
  MEKSQKEYEKLAASLNEARQELSDKVRELSRSAGKTSLVEEAEKHARSLQELAKQLEEIK
  RNASGDELVRCAVDAATAYENILNAIKAAEDAANRAASASESALQTVIKEDLPRKAKTLS
  SNSDKLLNEAKMTQKKLKQEVSPALNNLQQTLNIVTVQKEVIDTNLTTLRDGLHGIQRGD
  IDAMISSAKSMVRKANDITDEVLDGLNPIQTDVERIKDTYGRTQNEDFKKALTDADNSVN
  KLTNKLPDLWRKIESINQQLLPLGNISDNMDRIRELIQQARDAASKVAVPMRFNGKSGVE
  VRLPNDLEDLKGYTSLSLFLQRPNSRENGGTENMFVMYLGNKDASRDYIGMAVVDGQLTC
  VYNLGDREAELQVDQILTKSETKEAVMDRVKFQRIYQFARLNYTKGATSSKPETPGVYDM
  DGRNSNTLLNLDPENVVFYVGGYPPDFKLPSRLSFPPYKGCIELDDLNENVLSLYNFKKT
  FNLNTTEVEPCRRRKEESDKNYFEGTGYARVPTQPHAPIPTFGQTIQTTVDRGLLFFAEN
  GDRFISLNIEDGKLMVRYKLNSELPKERGVGDAINNGRDHSIQIKIGKLQKRMWINVDVQ
  NTIIDGEVFDFSTYYLGGIPIAIRERFNISTPAFRGCMKNLKKTSGVVRLNDTVGVTKKC
  SEDWKLVRSASFSRGGQLSFTDLGLPPTDHLQASFGFQTFQPSGILLDHQTWTRNLQVTL
  EDGYIELSTSDSGGPIFKSPQTYMDGLLHYVSVISDNSGLRLLIDDQLLRNSKRLKHISS
  SRQSLRLGGSNFEGCISNVFVQRLSLSPEVLDLTSNSLKRDVSLGGCSLNKPPFLMLLKG
  STRFNKTKTFRINQLLQDTPVASPRSVKVWQDACSPLPKTQANHGALQFGDIPTSHLLFK
  LPQELLKPRSQFAVDMQTTSSRGLVFHTGTKNSFMALYLSKGRLVFALGTDGKKLRIKSK
  EKCNDGKWHTVVFGHDGEKGRLVVDGLRAREGSLPGNSTISIRAPVYLGSPPSGKPKSLP
  TNSFVGCLKNFQLDSKPLYTPSSSFGVSSCLGGPLEKGIYFSEEGGHVVLAHSVLLGPEF
  KLVFSIRPRSLTGILIHIGSQPGKHLCVYLEAGKVTASMDSGAGGTSTSVTPKQSLCDGQ
  WHSVAVTIKQHILHLELDTDSSYTAGQIPFPPASTQEPLHLGGAPANLTTLRIPVWKSFF
  GCLRNIHVNHIPVPVTEALEVQGPVSLNGCPDQ
• Function: Binding to cells via a high affinity receptor, laminin is thought to mediate the attachment, migration and organization of cells into tissues during embryonic development by interacting with other extracellular matrix components.; Laminin-5 is thought to be involved in (1) cell adhesion via integrin alpha-3/beta-1 in focal adhesion and integrin alpha-6/beta-4 in hemidesmosomes, (2) signal transduction via tyrosine phosphorylation of pp125-FAK and p80, (3) differentiation of keratinocytes.
• Tissue Specificity: Skin; respiratory, urinary, and digestive epithelia and in other specialized tissues with prominent secretory or protective functions. Epithelial basement membrane, and epithelial cell tongue that migrates into a wound bed. A differential and focal expression of the subunit alpha-3 is observed in the CNS.
• KEGG Pathway:
  PI3K-Akt sig.ling pathway (hsa04151)
  Focal adhesion (hsa04510)
  ECM-receptor interaction (hsa04512)
  Toxoplasmosis (hsa05145)
  Amoebiasis (hsa05146)
  Human papillomavirus infection (hsa05165)
  Pathways in cancer (hsa05200)
  Small cell lung cancer (hsa05222)
• Reactome Pathway:
  Assembly of collagen fibrils and other multimeric structures (R-HSA-2022090)
  Anchoring fibril formation (R-HSA-2214320)
  Laminin interactions (R-HSA-3000157)
  Non-integrin membrane-ECM interactions (R-HSA-3000171)
  ECM proteoglycans (R-HSA-3000178)
  Type I hemidesmosome assembly (R-HSA-446107)
  MET activates PTK2 signaling (R-HSA-8874081)
  Degradation of the extracellular matrix (R-HSA-1474228)

Molecular Interaction Atlas (MIA) of This DOT

35 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Adenocarcinoma	DIS3IHTY	Definitive	Genetic Variation	[1]
Chronic kidney disease	DISW82R7	Definitive	Genetic Variation	[2]
Junctional epidermolysis bullosa	DISJRXWU	Definitive	Autosomal recessive	[3]
Amelogenesis imperfecta type 1	DISVEG5A	Strong	Biomarker	[4]
Amyotrophic lateral sclerosis	DISF7HVM	Strong	Genetic Variation	[5]
Breast cancer	DIS7DPX1	Strong	Posttranslational Modification	[6]
Breast neoplasm	DISNGJLM	Strong	Posttranslational Modification	[6]
Cataract	DISUD7SL	Strong	Biomarker	[7]
Colorectal carcinoma	DIS5PYL0	Strong	Genetic Variation	[8]
Dermatitis	DISY5SZC	Strong	Genetic Variation	[9]
Early-onset posterior polar cataract	DISJFK9W	Strong	Biomarker	[10]
Epidermolysis bullosa	DISVOTZQ	Strong	Genetic Variation	[11]
Epithelial ovarian cancer	DIS56MH2	Strong	Biomarker	[12]
Glioblastoma multiforme	DISK8246	Strong	Biomarker	[13]
Head-neck squamous cell carcinoma	DISF7P24	Strong	Biomarker	[14]
Junctional epidermolysis bullosa Herlitz type	DIS6X2W8	Strong	Autosomal recessive	[15]
Junctional epidermolysis bullosa, non-Herlitz type	DISQM23S	Strong	Autosomal recessive	[15]
Laryngo-onycho-cutaneous syndrome	DISBRH8M	Strong	Autosomal recessive	[15]
Lung adenocarcinoma	DISD51WR	Strong	Biomarker	[16]
Matthew-Wood syndrome	DISA7HR7	Strong	Biomarker	[17]
Myocardial infarction	DIS655KI	Strong	Genetic Variation	[18]
Nail disorder	DISE7ZR0	Strong	Biomarker	[19]
Neoplasm	DISZKGEW	Strong	Genetic Variation	[20]
Ovarian cancer	DISZJHAP	Strong	Biomarker	[12]
Ovarian neoplasm	DISEAFTY	Strong	Biomarker	[12]
Prion disease	DISOUMB0	Strong	Genetic Variation	[21]
Prostate cancer	DISF190Y	Strong	Biomarker	[22]
Skin disease	DISDW8R6	Strong	Genetic Variation	[23]
Age-related macular degeneration	DIS0XS2C	moderate	Biomarker	[24]
Allergic rhinitis	DIS3U9HN	moderate	Genetic Variation	[25]
Generalized junctional epidermolysis bullosa non-Herlitz type	DISSD3MX	Supportive	Autosomal recessive	[26]
Adenoma	DIS78ZEV	Disputed	Genetic Variation	[1]
Rheumatoid arthritis	DISTSB4J	Disputed	Biomarker	[27]
Cervical Intraepithelial neoplasia	DISXP757	Limited	Genetic Variation	[20]
Ovarian serous adenocarcinoma	DISSU72Z	Limited	Genetic Variation	[28]

27 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Laminin subunit alpha-3 (LAMA3).	[29]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Laminin subunit alpha-3 (LAMA3).	[30]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Laminin subunit alpha-3 (LAMA3).	[31]
Doxorubicin	DMVP5YE	Approved	Doxorubicin increases the expression of Laminin subunit alpha-3 (LAMA3).	[32]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of Laminin subunit alpha-3 (LAMA3).	[33]
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of Laminin subunit alpha-3 (LAMA3).	[34]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide increases the expression of Laminin subunit alpha-3 (LAMA3).	[35]
Calcitriol	DM8ZVJ7	Approved	Calcitriol decreases the expression of Laminin subunit alpha-3 (LAMA3).	[36]
Zoledronate	DMIXC7G	Approved	Zoledronate increases the expression of Laminin subunit alpha-3 (LAMA3).	[37]
Isotretinoin	DM4QTBN	Approved	Isotretinoin decreases the expression of Laminin subunit alpha-3 (LAMA3).	[31]
Cidofovir	DMA13GD	Approved	Cidofovir affects the expression of Laminin subunit alpha-3 (LAMA3).	[38]
Mifepristone	DMGZQEF	Approved	Mifepristone decreases the expression of Laminin subunit alpha-3 (LAMA3).	[39]
Ifosfamide	DMCT3I8	Approved	Ifosfamide increases the expression of Laminin subunit alpha-3 (LAMA3).	[38]
Clodronate	DM9Y6X7	Approved	Clodronate increases the expression of Laminin subunit alpha-3 (LAMA3).	[38]
Alitretinoin	DMME8LH	Approved	Alitretinoin decreases the expression of Laminin subunit alpha-3 (LAMA3).	[31]
Ibuprofen	DM8VCBE	Approved	Ibuprofen decreases the expression of Laminin subunit alpha-3 (LAMA3).	[38]
Palbociclib	DMD7L94	Approved	Palbociclib increases the expression of Laminin subunit alpha-3 (LAMA3).	[40]
Adefovir dipivoxil	DMMAWY1	Approved	Adefovir dipivoxil increases the expression of Laminin subunit alpha-3 (LAMA3).	[38]
Dihydrotestosterone	DM3S8XC	Phase 4	Dihydrotestosterone increases the expression of Laminin subunit alpha-3 (LAMA3).	[42]
Sphingosine-1-Phosphate	DMJCQKA	Phase 1	Sphingosine-1-Phosphate increases the expression of Laminin subunit alpha-3 (LAMA3).	[44]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of Laminin subunit alpha-3 (LAMA3).	[45]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the expression of Laminin subunit alpha-3 (LAMA3).	[46]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde decreases the expression of Laminin subunit alpha-3 (LAMA3).	[47]
chloropicrin	DMSGBQA	Investigative	chloropicrin decreases the expression of Laminin subunit alpha-3 (LAMA3).	[48]
all-trans-4-oxo-retinoic acid	DMM2R1N	Investigative	all-trans-4-oxo-retinoic acid decreases the expression of Laminin subunit alpha-3 (LAMA3).	[31]
LPA	DMI5XR1	Investigative	LPA increases the expression of Laminin subunit alpha-3 (LAMA3).	[44]
Lysophosphatidylcholine	DMOGFVH	Investigative	Lysophosphatidylcholine increases the expression of Laminin subunit alpha-3 (LAMA3).	[44]

1 Drug(s) Affected the Protein Interaction/Cellular Processes of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ximelegatran	DMU8ANS	Approved	Ximelegatran affects the localization of Laminin subunit alpha-3 (LAMA3).	[41]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of Laminin subunit alpha-3 (LAMA3).	[43]

References

• [1] Exome capture sequencing of adenoma reveals genetic alterations in multiple cellular pathways at the early stage of colorectal tumorigenesis.PLoS One. 2013;8(1):e53310. doi: 10.1371/journal.pone.0053310. Epub 2013 Jan 2.
• [2] Genetic risk for myocardial infarction in Japanese individuals with or without chronic kidney disease.Int J Mol Med. 2010 May;25(5):743-9. doi: 10.3892/ijmm_00000400.
• [3] Technical standards for the interpretation and reporting of constitutional copy-number variants: a joint consensus recommendation of the American College of Medical Genetics and Genomics (ACMG) and the Clinical Genome Resource (ClinGen). Genet Med. 2020 Feb;22(2):245-257. doi: 10.1038/s41436-019-0686-8. Epub 2019 Nov 6.
• [4] Carriers with functional null mutations in LAMA3 have localized enamel abnormalities due to haploinsufficiency.Eur J Hum Genet. 2016 Jan;25(1):94-99. doi: 10.1038/ejhg.2016.136. Epub 2016 Nov 9.
• [5] Age of onset of amyotrophic lateral sclerosis is modulated by a locus on 1p34.1.Neurobiol Aging. 2013 Jan;34(1):357.e7-19. doi: 10.1016/j.neurobiolaging.2012.07.017. Epub 2012 Sep 5.
• [6] Aberrant promoter methylation and silencing of laminin-5-encoding genes in breast carcinoma.Clin Cancer Res. 2003 Dec 15;9(17):6389-94.
• [7] Influence of cataract light scatters on retinal vessel oxygen saturation.Acta Ophthalmol. 2020 Feb;98(1):e56-e62. doi: 10.1111/aos.14200. Epub 2019 Oct 25.
• [8] Laminin gene LAMB4 is somatically mutated and expressionally altered in gastric and colorectal cancers.APMIS. 2015 Jan;123(1):65-71. doi: 10.1111/apm.12309. Epub 2014 Sep 25.
• [9] Targeted Disruption of the Lama3 Gene in Adult Mice Is Sufficient to Induce Skin Inflammation and Fibrosis.J Invest Dermatol. 2017 Feb;137(2):332-340. doi: 10.1016/j.jid.2016.07.040. Epub 2016 Oct 8.
• [10] The Lens Opacities Classification System III Grading in Irradiated Uveal Melanomas to Characterize Proton Therapy-Induced Cataracts.Am J Ophthalmol. 2019 May;201:63-71. doi: 10.1016/j.ajo.2019.01.025. Epub 2019 Feb 2.
• [11] Detection of novel LAMA3 mutation in Herlitz junctional epidermolysis bullosa in a Jordanian family.Australas J Dermatol. 2013 Aug;54(3):218-21. doi: 10.1111/j.1440-0960.2012.00945.x. Epub 2012 Sep 11.
• [12] Correlation of LAMA3 with onset and prognosis of ovarian cancer.Oncol Lett. 2019 Sep;18(3):2813-2818. doi: 10.3892/ol.2019.10600. Epub 2019 Jul 10.
• [13] Signaling adaptor protein Crk is indispensable for malignant feature of glioblastoma cell line KMG4.Biochem Biophys Res Commun. 2007 Nov 3;362(4):976-81. doi: 10.1016/j.bbrc.2007.08.106. Epub 2007 Aug 27.
• [14] Expression microarray analysis reveals alternative splicing of LAMA3 and DST genes in head and neck squamous cell carcinoma.PLoS One. 2014 Mar 27;9(3):e91263. doi: 10.1371/journal.pone.0091263. eCollection 2014.
• [15] The Gene Curation Coalition: A global effort to harmonize gene-disease evidence resources. Genet Med. 2022 Aug;24(8):1732-1742. doi: 10.1016/j.gim.2022.04.017. Epub 2022 May 4.
• [16] Long Non-coding RNA LINC00628 Interacts Epigenetically with the LAMA3 Promoter and Contributes to Lung Adenocarcinoma.Mol Ther Nucleic Acids. 2019 Dec 6;18:166-182. doi: 10.1016/j.omtn.2019.08.005. Epub 2019 Aug 14.
• [17] Evaluation of the diagnostic ability of laminin gene family for pancreatic ductal adenocarcinoma.Aging (Albany NY). 2019 Jun 10;11(11):3679-3703. doi: 10.18632/aging.102007.
• [18] Association of a polymorphism of BTN2A1 with myocardial infarction in East Asian populations.Atherosclerosis. 2011 Mar;215(1):145-52. doi: 10.1016/j.atherosclerosis.2010.12.005. Epub 2010 Dec 15.
• [19] An unusual N-terminal deletion of the laminin alpha3a isoform leads to the chronic granulation tissue disorder laryngo-onycho-cutaneous syndrome. Hum Mol Genet. 2003 Sep 15;12(18):2395-409. doi: 10.1093/hmg/ddg234. Epub 2003 Jul 15.
• [20] Array CGH identifies distinct DNA copy number profiles of oncogenes and tumor suppressor genes in chromosomal- and microsatellite-unstable sporadic colorectal carcinomas.J Mol Med (Berl). 2007 Mar;85(3):293-304. doi: 10.1007/s00109-006-0126-5. Epub 2006 Dec 2.
• [21] Biological network inferences for a protection mechanism against familial Creutzfeldt-Jakob disease with E200K pathogenic mutation.BMC Med Genomics. 2014 Aug 22;7:52. doi: 10.1186/1755-8794-7-52.
• [22] Aberrant promoter methylation of laminin-5-encoding genes in prostate cancers and its relationship to clinicopathological features.Clin Cancer Res. 2003 Dec 15;9(17):6395-400.
• [23] A recurrent laminin 5 mutation in British patients with lethal (Herlitz) junctional epidermolysis bullosa: evidence for a mutational hotspot rather than propagation of an ancestral allele.Br J Dermatol. 1997 May;136(5):674-7.
• [24] The association of smokeless tobacco use and pack-years of smokeless tobacco with age-related macular degeneration in Indian population.Cutan Ocul Toxicol. 2017 Sep;36(3):253-258. doi: 10.1080/15569527.2016.1265548. Epub 2017 Jan 11.
• [25] Integrated genome-wide association, coexpression network, and expression single nucleotide polymorphism analysis identifies novel pathway in allergic rhinitis.BMC Med Genomics. 2014 Aug 2;7:48. doi: 10.1186/1755-8794-7-48.
• [26] Junctional Epidermolysis Bullosa. 2008 Feb 22 [updated 2018 Dec 20]. In: Adam MP, Feldman J, Mirzaa GM, Pagon RA, Wallace SE, Bean LJH, Gripp KW, Amemiya A, editors. GeneReviews(?) [Internet]. Seattle (WA): University of Washington, Seattle; 1993C2024.
• [27] Identification of key genes associated with rheumatoid arthritis with bioinformatics approach.Medicine (Baltimore). 2017 Aug;96(31):e7673. doi: 10.1097/MD.0000000000007673.
• [28] Identification of 12 new susceptibility loci for different histotypes of epithelial ovarian cancer.Nat Genet. 2017 May;49(5):680-691. doi: 10.1038/ng.3826. Epub 2017 Mar 27.
• [29] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [30] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [31] Retinoic acid and its 4-oxo metabolites are functionally active in human skin cells in vitro. J Invest Dermatol. 2005 Jul;125(1):143-53.
• [32] Pretreatment of 3-MA prevents doxorubicin-induced cardiotoxicity through inhibition of autophagy initiation. Toxicology. 2023 May 15;490:153512. doi: 10.1016/j.tox.2023.153512. Epub 2023 Apr 14.
• [33] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [34] Long-term estrogen exposure promotes carcinogen bioactivation, induces persistent changes in gene expression, and enhances the tumorigenicity of MCF-7 human breast cancer cells. Toxicol Appl Pharmacol. 2009 Nov 1;240(3):355-66.
• [35] Essential role of cell cycle regulatory genes p21 and p27 expression in inhibition of breast cancer cells by arsenic trioxide. Med Oncol. 2011 Dec;28(4):1225-54.
• [36] Identification of vitamin D3 target genes in human breast cancer tissue. J Steroid Biochem Mol Biol. 2016 Nov;164:90-97.
• [37] The proapoptotic effect of zoledronic acid is independent of either the bone microenvironment or the intrinsic resistance to bortezomib of myeloma cells and is enhanced by the combination with arsenic trioxide. Exp Hematol. 2011 Jan;39(1):55-65.
• [38] Transcriptomics hit the target: monitoring of ligand-activated and stress response pathways for chemical testing. Toxicol In Vitro. 2015 Dec 25;30(1 Pt A):7-18.
• [39] Mifepristone induced progesterone withdrawal reveals novel regulatory pathways in human endometrium. Mol Hum Reprod. 2007 Sep;13(9):641-54.
• [40] Cdk4/6 inhibition induces epithelial-mesenchymal transition and enhances invasiveness in pancreatic cancer cells. Mol Cancer Ther. 2012 Oct;11(10):2138-48. doi: 10.1158/1535-7163.MCT-12-0562. Epub 2012 Aug 6.
• [41] Myosin-mediated cytoskeleton contraction and Rho GTPases regulate laminin-5 matrix assembly. Cell Motil Cytoskeleton. 2004 Feb;57(2):107-17. doi: 10.1002/cm.10161.
• [42] LSD1 activates a lethal prostate cancer gene network independently of its demethylase function. Proc Natl Acad Sci U S A. 2018 May 1;115(18):E4179-E4188.
• [43] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [44] Increase of laminin 5 synthesis in human keratinocytes by acute wound fluid, inflammatory cytokines and growth factors, and lysophospholipids. Br J Dermatol. 2004 Nov;151(5):961-70. doi: 10.1111/j.1365-2133.2004.06175.x.
• [45] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [46] Bisphenol A and bisphenol S induce distinct transcriptional profiles in differentiating human primary preadipocytes. PLoS One. 2016 Sep 29;11(9):e0163318.
• [47] Gene expression changes in primary human nasal epithelial cells exposed to formaldehyde in vitro. Toxicol Lett. 2010 Oct 5;198(2):289-95.
• [48] Molecular targets of chloropicrin in human airway epithelial cells. Toxicol In Vitro. 2017 Aug;42:247-254.