Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTUCRYXL)

• DOT Name: Annexin A4 (ANXA4)
• Synonyms: 35-beta calcimedin; Annexin IV; Annexin-4; Carbohydrate-binding protein p33/p41; Chromobindin-4; Endonexin I; Lipocortin IV; P32.5; PP4-X; Placental anticoagulant protein II; PAP-II; Protein II
• Gene Name: ANXA4
• Related Disease:
  Carcinoma
  Epithelial ovarian cancer
  Gastric neoplasm
  Malaria
  Rheumatoid arthritis
  Acute erythroid leukemia
  Acute myelogenous leukaemia
  Adenocarcinoma
  Advanced cancer
  Alcohol use disorder
  Atrial fibrillation
  Breast cancer
  Breast carcinoma
  Cholangiocarcinoma
  Colorectal carcinoma
  Depression
  Hepatocellular carcinoma
  Liver cancer
  Lung cancer
  Lung carcinoma
  Malignant mesothelioma
  Neoplasm
  Non-small-cell lung cancer
  Ovarian cancer
  Ovarian neoplasm
  Ovarian serous adenocarcinoma
  Papillary renal cell carcinoma
  Precancerous condition
  Prostate cancer
  Prostate neoplasm
  Renal cell carcinoma
  Metastatic malignant neoplasm
  Clear cell renal carcinoma
  Undifferentiated carcinoma
  Asthma
  Clear cell adenocarcinoma
  Gastric cancer
  Mesothelioma
  Stomach cancer
• UniProt ID: ANXA4_HUMAN
• PDB ID: 2ZOC
• Pfam ID: PF00191
• Sequence:
  MATKGGTVKAASGFNAMEDAQTLRKAMKGLGTDEDAIISVLAYRNTAQRQEIRTAYKSTI
  GRDLIDDLKSELSGNFEQVIVGMMTPTVLYDVQELRRAMKGAGTDEGCLIEILASRTPEE
  IRRISQTYQQQYGRSLEDDIRSDTSFMFQRVLVSLSAGGRDEGNYLDDALVRQDAQDLYE
  AGEKKWGTDEVKFLTVLCSRNRNHLLHVFDEYKRISQKDIEQSIKSETSGSFEDALLAIV
  KCMRNKSAYFAEKLYKSMKGLGTDDNTLIRVMVSRAEIDMLDIRAHFKRLYGKSLYSFIK
  GDTSGDYRKVLLVLCGGDD
• Function: Calcium/phospholipid-binding protein which promotes membrane fusion and is involved in exocytosis.

Molecular Interaction Atlas (MIA) of This DOT

39 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Carcinoma	DISH9F1N	Definitive	Biomarker	[1]
Epithelial ovarian cancer	DIS56MH2	Definitive	Altered Expression	[2]
Gastric neoplasm	DISOKN4Y	Definitive	Biomarker	[3]
Malaria	DISQ9Y50	Definitive	Biomarker	[4]
Rheumatoid arthritis	DISTSB4J	Definitive	Biomarker	[5]
Acute erythroid leukemia	DISZFC1O	Strong	Altered Expression	[6]
Acute myelogenous leukaemia	DISCSPTN	Strong	Biomarker	[7]
Adenocarcinoma	DIS3IHTY	Strong	Altered Expression	[6]
Advanced cancer	DISAT1Z9	Strong	Biomarker	[8]
Alcohol use disorder	DISMB65Y	Strong	Biomarker	[9]
Atrial fibrillation	DIS15W6U	Strong	Genetic Variation	[10]
Breast cancer	DIS7DPX1	Strong	Biomarker	[11]
Breast carcinoma	DIS2UE88	Strong	Biomarker	[11]
Cholangiocarcinoma	DIS71F6X	Strong	Biomarker	[12]
Colorectal carcinoma	DIS5PYL0	Strong	Biomarker	[8]
Depression	DIS3XJ69	Strong	Biomarker	[9]
Hepatocellular carcinoma	DIS0J828	Strong	Altered Expression	[13]
Liver cancer	DISDE4BI	Strong	Biomarker	[14]
Lung cancer	DISCM4YA	Strong	Biomarker	[15]
Lung carcinoma	DISTR26C	Strong	Biomarker	[15]
Malignant mesothelioma	DISTHJGH	Strong	Biomarker	[11]
Neoplasm	DISZKGEW	Strong	Biomarker	[8]
Non-small-cell lung cancer	DIS5Y6R9	Strong	Altered Expression	[16]
Ovarian cancer	DISZJHAP	Strong	Biomarker	[8]
Ovarian neoplasm	DISEAFTY	Strong	Biomarker	[8]
Ovarian serous adenocarcinoma	DISSU72Z	Strong	Biomarker	[8]
Papillary renal cell carcinoma	DIS25HBV	Strong	Biomarker	[17]
Precancerous condition	DISV06FL	Strong	Biomarker	[14]
Prostate cancer	DISF190Y	Strong	Altered Expression	[8]
Prostate neoplasm	DISHDKGQ	Strong	Biomarker	[18]
Renal cell carcinoma	DISQZ2X8	Strong	Biomarker	[19]
Metastatic malignant neoplasm	DIS86UK6	moderate	Altered Expression	[20]
Clear cell renal carcinoma	DISBXRFJ	Disputed	Biomarker	[19]
Undifferentiated carcinoma	DISIAZST	Disputed	Biomarker	[1]
Asthma	DISW9QNS	Limited	Genetic Variation	[21]
Clear cell adenocarcinoma	DISYUGHZ	Limited	Altered Expression	[22]
Gastric cancer	DISXGOUK	Limited	Posttranslational Modification	[23]
Mesothelioma	DISKWK9M	Limited	Biomarker	[24]
Stomach cancer	DISKIJSX	Limited	Posttranslational Modification	[23]

This DOT Affected the Drug Response of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Paclitaxel	DMLB81S	Approved	Annexin A4 (ANXA4) decreases the response to substance of Paclitaxel.	[55]

32 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Annexin A4 (ANXA4).	[25]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Annexin A4 (ANXA4).	[26]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Annexin A4 (ANXA4).	[27]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Annexin A4 (ANXA4).	[28]
Doxorubicin	DMVP5YE	Approved	Doxorubicin increases the expression of Annexin A4 (ANXA4).	[29]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Annexin A4 (ANXA4).	[30]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of Annexin A4 (ANXA4).	[31]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Annexin A4 (ANXA4).	[32]
Quercetin	DM3NC4M	Approved	Quercetin increases the expression of Annexin A4 (ANXA4).	[34]
Temozolomide	DMKECZD	Approved	Temozolomide decreases the expression of Annexin A4 (ANXA4).	[35]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide affects the expression of Annexin A4 (ANXA4).	[36]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of Annexin A4 (ANXA4).	[37]
Fluorouracil	DMUM7HZ	Approved	Fluorouracil decreases the expression of Annexin A4 (ANXA4).	[38]
Dexamethasone	DMMWZET	Approved	Dexamethasone increases the expression of Annexin A4 (ANXA4).	[39]
Niclosamide	DMJAGXQ	Approved	Niclosamide increases the expression of Annexin A4 (ANXA4).	[40]
Etoposide	DMNH3PG	Approved	Etoposide increases the expression of Annexin A4 (ANXA4).	[41]
Daunorubicin	DMQUSBT	Approved	Daunorubicin increases the expression of Annexin A4 (ANXA4).	[41]
Phenytoin	DMNOKBV	Approved	Phenytoin increases the expression of Annexin A4 (ANXA4).	[42]
Enzalutamide	DMGL19D	Approved	Enzalutamide affects the expression of Annexin A4 (ANXA4).	[43]
Urethane	DM7NSI0	Phase 4	Urethane decreases the expression of Annexin A4 (ANXA4).	[44]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 increases the expression of Annexin A4 (ANXA4).	[45]
Epigallocatechin gallate	DMCGWBJ	Phase 3	Epigallocatechin gallate decreases the expression of Annexin A4 (ANXA4).	[46]
Camptothecin	DM6CHNJ	Phase 3	Camptothecin increases the expression of Annexin A4 (ANXA4).	[41]
Amiodarone	DMUTEX3	Phase 2/3 Trial	Amiodarone increases the expression of Annexin A4 (ANXA4).	[47]
Belinostat	DM6OC53	Phase 2	Belinostat decreases the expression of Annexin A4 (ANXA4).	[48]
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 decreases the expression of Annexin A4 (ANXA4).	[46]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the expression of Annexin A4 (ANXA4).	[39]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A increases the expression of Annexin A4 (ANXA4).	[50]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde increases the expression of Annexin A4 (ANXA4).	[51]
methyl p-hydroxybenzoate	DMO58UW	Investigative	methyl p-hydroxybenzoate decreases the expression of Annexin A4 (ANXA4).	[52]
[3H]methyltrienolone	DMTSGOW	Investigative	[3H]methyltrienolone increases the expression of Annexin A4 (ANXA4).	[53]
Butanoic acid	DMTAJP7	Investigative	Butanoic acid decreases the expression of Annexin A4 (ANXA4).	[54]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Arsenic	DMTL2Y1	Approved	Arsenic affects the methylation of Annexin A4 (ANXA4).	[33]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Annexin A4 (ANXA4).	[49]

References

• [1] Global gene expression profiling of chemically induced rat mammary gland carcinomas and adenomas.Toxicol Pathol. 2005;33(7):768-75. doi: 10.1080/01926230500437027.
• [2] Annexin A4 fucosylation enhances its interaction with the NF-kB p50 and promotes tumor progression of ovarian clear cell carcinoma.Oncotarget. 2016 Jun 22;8(64):108093-108107. doi: 10.18632/oncotarget.10226. eCollection 2017 Dec 8.
• [3] Revealing the molecular mechanism of gastric cancer marker annexin A4 in cancer cell proliferation using exon arrays.PLoS One. 2012;7(9):e44615. doi: 10.1371/journal.pone.0044615. Epub 2012 Sep 7.
• [4] Fermentation and downstream process for high yield production of Plasmodium falciparum recombinant HRP II protein and its application in diagnosis.J Ind Microbiol Biotechnol. 2013 Jul;40(7):687-95. doi: 10.1007/s10295-013-1270-x. Epub 2013 Apr 23.
• [5] Phosphoproteome analysis of synoviocytes from patients with rheumatoid arthritis.Int J Rheum Dis. 2017 Jun;20(6):708-721. doi: 10.1111/1756-185X.12997. Epub 2017 Mar 5.
• [6] Modulation of cell surface lectin receptors on K562 human erythroleukemia cells induced by transfection with annexin IV cDNA.FEBS Lett. 1997 Mar 17;405(1):107-10. doi: 10.1016/s0014-5793(97)00161-0.
• [7] Discovery of epigenetically silenced genes in acute myeloid leukemias.Leukemia. 2007 May;21(5):1026-34. doi: 10.1038/sj.leu.2404611. Epub 2007 Mar 1.
• [8] The role of annexin A4 in cancer.Front Biosci (Landmark Ed). 2016 Jun 1;21(5):949-57. doi: 10.2741/4432.
• [9] Inhibition of AMPA receptor and CaMKII activity in the lateral habenula reduces depressive-like behavior and alcohol intake in rats.Neuropharmacology. 2017 Nov;126:108-120. doi: 10.1016/j.neuropharm.2017.08.035. Epub 2017 Aug 31.
• [10] Large-scale analyses of common and rare variants identify 12 new loci associated with atrial fibrillation.Nat Genet. 2017 Jun;49(6):946-952. doi: 10.1038/ng.3843. Epub 2017 Apr 17.
• [11] Development and Evaluation of Antibody Proteomics Technology for Rapid and Comprehensive Identification of Potential Biomarkers and Therapeutic Targets.Biol Pharm Bull. 2018;41(5):663-669. doi: 10.1248/bpb.b17-01041.
• [12] Differential membrane proteomics using 18O-labeling to identify biomarkers for cholangiocarcinoma.J Proteome Res. 2008 Nov;7(11):4670-7. doi: 10.1021/pr800215n. Epub 2008 Oct 8.
• [13] The transcription factor Ikaros inhibits cell proliferation by downregulating ANXA4 expression in hepatocellular carcinoma.Am J Cancer Res. 2017 Jun 1;7(6):1285-1297. eCollection 2017.
• [14] Multiple genes exhibit phenobarbital-induced constitutive active/androstane receptor-mediated DNA methylation changes during liver tumorigenesis and in liver tumors.Toxicol Sci. 2009 Apr;108(2):273-89. doi: 10.1093/toxsci/kfp031. Epub 2009 Feb 20.
• [15] A Fhit-mimetic peptide suppresses annexin A4-mediated chemoresistance to paclitaxel in lung cancer cells.Oncotarget. 2016 May 24;7(21):29927-36. doi: 10.18632/oncotarget.9179.
• [16] Toosendanin mediates cisplatin sensitization through targeting Annexin A4/ATP7A in non-small cell lung cancer cells.J Nat Med. 2018 Jun;72(3):724-733. doi: 10.1007/s11418-018-1211-0. Epub 2018 Apr 7.
• [17] Differential protein profiling in renal-cell carcinoma.Mol Carcinog. 2004 May;40(1):47-61. doi: 10.1002/mc.20015.
• [18] Identification of genes potentially involved in the acquisition of androgen-independent and metastatic tumor growth in an autochthonous genetically engineered mouse prostate cancer model.Prostate. 2007 Jan 1;67(1):83-106. doi: 10.1002/pros.20505.
• [19] Genomic and proteomic approaches to renal cell carcinoma.J Nephrol. 2011 Mar-Apr;24(2):155-64. doi: 10.5301/jn.2010.90.
• [20] Overexpression of annexin A4 indicates poor prognosis and promotes tumor metastasis of hepatocellular carcinoma.Tumour Biol. 2016 Jul;37(7):9343-55. doi: 10.1007/s13277-016-4823-6. Epub 2016 Jan 16.
• [21] Potential association between ANXA4 polymorphisms and aspirin-exacerbated respiratory disease.Diagn Mol Pathol. 2012 Sep;21(3):164-71. doi: 10.1097/PDM.0b013e3182461d0d.
• [22] Enhanced expression of Annexin A4 in clear cell carcinoma of the ovary and its association with chemoresistance to carboplatin.Int J Cancer. 2009 Nov 15;125(10):2316-22. doi: 10.1002/ijc.24587.
• [23] miR-203 Inhibits the Invasion and EMT of Gastric Cancer Cells by Directly Targeting Annexin A4.Oncol Res. 2019 Jul 12;27(7):789-799. doi: 10.3727/096504018X15444387696532. Epub 2019 Mar 5.
• [24] Annexin A4 is a possible biomarker for cisplatin susceptibility of malignant mesothelioma cells.Biochem Biophys Res Commun. 2012 Apr 27;421(1):140-4. doi: 10.1016/j.bbrc.2012.03.144. Epub 2012 Apr 4.
• [25] Stem cell transcriptome responses and corresponding biomarkers that indicate the transition from adaptive responses to cytotoxicity. Chem Res Toxicol. 2017 Apr 17;30(4):905-922.
• [26] Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
• [27] Development of a neural teratogenicity test based on human embryonic stem cells: response to retinoic acid exposure. Toxicol Sci. 2011 Dec;124(2):370-7.
• [28] Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
• [29] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [30] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [31] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [32] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [33] Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
• [34] Identification of biomarkers for the initiation of apoptosis in human preneoplastic colonocytes by proteome analysis. Int J Cancer. 2004 Mar 20;109(2):220-9. doi: 10.1002/ijc.11692.
• [35] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [36] Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
• [37] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [38] Comparison of gene expression in HCT116 treatment derivatives generated by two different 5-fluorouracil exposure protocols. Mol Cancer. 2004 Apr 26;3:11.
• [39] Identification of mechanisms of action of bisphenol a-induced human preadipocyte differentiation by transcriptional profiling. Obesity (Silver Spring). 2014 Nov;22(11):2333-43.
• [40] Mitochondrial Uncoupling Induces Epigenome Remodeling and Promotes Differentiation in Neuroblastoma. Cancer Res. 2023 Jan 18;83(2):181-194. doi: 10.1158/0008-5472.CAN-22-1029.
• [41] Characterization of DNA reactive and non-DNA reactive anticancer drugs by gene expression profiling. Mutat Res. 2007 Jun 1;619(1-2):16-29. doi: 10.1016/j.mrfmmm.2006.12.007. Epub 2007 Feb 8.
• [42] Role of phenytoin in wound healing: microarray analysis of early transcriptional responses in human dermal fibroblasts. Biochem Biophys Res Commun. 2004 Feb 13;314(3):661-6. doi: 10.1016/j.bbrc.2003.12.146.
• [43] NOTCH signaling is activated in and contributes to resistance in enzalutamide-resistant prostate cancer cells. J Biol Chem. 2019 May 24;294(21):8543-8554. doi: 10.1074/jbc.RA118.006983. Epub 2019 Apr 2.
• [44] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [45] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [46] Comparative proteomics reveals concordant and discordant biochemical effects of caffeine versus epigallocatechin-3-gallate in human endothelial cells. Toxicol Appl Pharmacol. 2019 Sep 1;378:114621. doi: 10.1016/j.taap.2019.114621. Epub 2019 Jun 10.
• [47] Identification by automated screening of a small molecule that selectively eliminates neural stem cells derived from hESCs but not dopamine neurons. PLoS One. 2009 Sep 23;4(9):e7155.
• [48] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [49] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [50] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [51] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
• [52] Transcriptome dynamics of alternative splicing events revealed early phase of apoptosis induced by methylparaben in H1299 human lung carcinoma cells. Arch Toxicol. 2020 Jan;94(1):127-140. doi: 10.1007/s00204-019-02629-w. Epub 2019 Nov 20.
• [53] Evaluation of an in vitro model of androgen ablation and identification of the androgen responsive proteome in LNCaP cells. Proteomics. 2007 Jan;7(1):47-63.
• [54] MS4A3-HSP27 target pathway reveals potential for haematopoietic disorder treatment in alimentary toxic aleukia. Cell Biol Toxicol. 2023 Feb;39(1):201-216. doi: 10.1007/s10565-021-09639-4. Epub 2021 Sep 28.
• [55] Current recommendations for systemic therapy of recurrent and/or metastatic head and neck squamous cell cancer. J Natl Compr Canc Netw. 2011 Jun 1;9(6):681-9. doi: 10.6004/jnccn.2011.0056.