Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTWD2278)

• DOT Name: Retrotransposon-derived protein PEG10 (PEG10)
• Synonyms: Embryonal carcinoma differentiation-regulated protein; Mammalian retrotransposon-derived protein 2; Myelin expression factor 3-like protein 1; MEF3-like protein 1; Paternally expressed gene 10 protein; Retrotransposon gag domain-containing protein 3; Retrotransposon-derived gag-like polyprotein; Ty3/Gypsy-like protein
• Gene Name: PEG10
• Related Disease:
  Blast phase chronic myelogenous leukemia, BCR-ABL1 positive
  Chondrosarcoma
  Acute erythroid leukemia
  Adenocarcinoma
  Atrichia with papular lesions
  Autism spectrum disorder
  Breast cancer
  Carcinoma
  Carcinoma of esophagus
  Depression
  Ductal breast carcinoma in situ
  Esophageal cancer
  Fetal growth restriction
  Glioma
  Hepatocellular carcinoma
  Hypopharyngeal squamous cell carcinoma
  Lung squamous cell carcinoma
  Malignant glioma
  Neoplasm
  Neoplasm of esophagus
  Promyelocytic leukaemia
  Prostate adenocarcinoma
  Prostate carcinoma
  Rectal adenocarcinoma
  Silver-Russell syndrome
  Small lymphocytic lymphoma
  Lung cancer
  Lung carcinoma
  Prostate cancer
  Squamous cell carcinoma
  Advanced cancer
  Bladder cancer
  Gastric cancer
  Lateral meningocele syndrome
  Leiomyosarcoma
  Limb-mammary syndrome
  Melanoma
  Metastatic melanoma
  Pancreatic cancer
  Stomach cancer
  Urinary bladder cancer
  Urinary bladder neoplasm
• UniProt ID: PEG10_HUMAN
• PDB ID: 7LGA
• Pfam ID: PF16297
• Sequence:
  MTERRRDELSEEINNLREKVMKQSEENNNLQSQVQKLTEENTTLREQVEPTPEDEDDDIE
  LRGAAAAAAPPPPIEEECPEDLPEKFDGNPDMLAPFMAQCQIFMEKSTRDFSVDRVRVCF
  VTSMMTGRAARWASAKLERSHYLMHNYPAFMMEMKHVFEDPQRREVAKRKIRRLRQGMGS
  VIDYSNAFQMIAQDLDWNEPALIDQYHEGLSDHIQEELSHLEVAKSLSALIGQCIHIERR
  LARAAAARKPRSPPRALVLPHIASHHQVDPTEPVGGARMRLTQEEKERRRKLNLCLYCGT
  GGHYADNCPAKASKSSPAGKLPGPAVEGPSATGPEIIRSPQDDASSPHLQVMLQIHLPGR
  HTLFVRAMIDSGASGNFIDHEYVAQNGIPLRIKDWPILVEAIDGRPIASGPVVHETHDLI
  VDLGDHREVLSFDVTQSPFFPVVLGVRWLSTHDPNITWSTRSIVFDSEYCRYHCRMYSPI
  PPSLPPPAPQPPLYYPVDGYRVYQPVRYYYVQNVYTPVDEHVYPDHRLVDPHIEMIPGAH
  SIPSGHVYSLSEPEMAALRDFVARNVKDGLITPTIAPNGAQVLQVKRGWKLQVSYDCRAP
  NNFTIQNQYPRLSIPNLEDQAHLATYTEFVPQIPGYQTYPTYAAYPTYPVGFAWYPVGRD
  GQGRSLYVPVMITWNPHWYRQPPVPQYPPPQPPPPPPPPPPPPSYSTL
• Function: Retrotransposon-derived protein that binds its own mRNA and self-assembles into virion-like capsids. Forms virion-like extracellular vesicles that encapsulate their own mRNA and are released from cells, enabling intercellular transfer of PEG10 mRNA. Binds its own mRNA in the 5'-UTR region, in the region near the boundary between the nucleocapsid (NC) and protease (PRO) coding sequences and in the beginning of the 3'-UTR region. Involved in placenta formation: required for trophoblast stem cells differentiation. Involved at the immediate early stage of adipocyte differentiation. Overexpressed in many cancers and enhances tumor progression: promotes cell proliferation by driving cell cycle progression from G0/G1. Enhances cancer progression by inhibiting the TGF-beta signaling, possibly via interaction with the TGF-beta receptor ACVRL1. May bind to the 5'-GCCTGTCTTT-3' DNA sequence of the MB1 domain in the myelin basic protein (MBP) promoter; additional evidences are however required to confirm this result.
• Tissue Specificity: Expressed in the cytotrophoblast layer but not in the overlying syncytiotrophoblast of the placenta. Expressed in prostate and breast carcinomas but not in normal breast and prostate epithelial cells. Expressed in the Hep-G2 cell line (at protein level). Expressed in brain, liver, spleen, kidney, thymus, lung, ovary, testis, reactive lymph node, skeletal muscle, adipose tissue and placenta. Expressed in pancreatic and hepatocellular carcinomas (HCC).

Molecular Interaction Atlas (MIA) of This DOT

42 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Blast phase chronic myelogenous leukemia, BCR-ABL1 positive	DIS3KLUX	Definitive	Biomarker	[1]
Chondrosarcoma	DIS4I7JB	Definitive	Biomarker	[2]
Acute erythroid leukemia	DISZFC1O	Strong	Genetic Variation	[3]
Adenocarcinoma	DIS3IHTY	Strong	Biomarker	[4]
Atrichia with papular lesions	DIS80CUB	Strong	Biomarker	[5]
Autism spectrum disorder	DISXK8NV	Strong	Biomarker	[6]
Breast cancer	DIS7DPX1	Strong	Biomarker	[7]
Carcinoma	DISH9F1N	Strong	Altered Expression	[8]
Carcinoma of esophagus	DISS6G4D	Strong	Altered Expression	[9]
Depression	DIS3XJ69	Strong	Altered Expression	[10]
Ductal breast carcinoma in situ	DISLCJY7	Strong	Altered Expression	[11]
Esophageal cancer	DISGB2VN	Strong	Altered Expression	[9]
Fetal growth restriction	DIS5WEJ5	Strong	Altered Expression	[12]
Glioma	DIS5RPEH	Strong	Altered Expression	[13]
Hepatocellular carcinoma	DIS0J828	Strong	Altered Expression	[14]
Hypopharyngeal squamous cell carcinoma	DISDDD65	Strong	Altered Expression	[15]
Lung squamous cell carcinoma	DISXPIBD	Strong	Biomarker	[16]
Malignant glioma	DISFXKOV	Strong	Biomarker	[13]
Neoplasm	DISZKGEW	Strong	Biomarker	[17]
Neoplasm of esophagus	DISOLKAQ	Strong	Altered Expression	[9]
Promyelocytic leukaemia	DISYGG13	Strong	Biomarker	[5]
Prostate adenocarcinoma	DISBZYU8	Strong	Biomarker	[18]
Prostate carcinoma	DISMJPLE	Strong	Biomarker	[4]
Rectal adenocarcinoma	DIS8R9VO	Strong	Altered Expression	[19]
Silver-Russell syndrome	DISSVJ1D	Strong	Biomarker	[20]
Small lymphocytic lymphoma	DIS30POX	Strong	Altered Expression	[21]
Lung cancer	DISCM4YA	moderate	Altered Expression	[22]
Lung carcinoma	DISTR26C	moderate	Altered Expression	[22]
Prostate cancer	DISF190Y	moderate	Biomarker	[4]
Squamous cell carcinoma	DISQVIFL	moderate	Altered Expression	[23]
Advanced cancer	DISAT1Z9	Limited	Biomarker	[24]
Bladder cancer	DISUHNM0	Limited	Biomarker	[25]
Gastric cancer	DISXGOUK	Limited	Biomarker	[26]
Lateral meningocele syndrome	DISG74RP	Limited	Genetic Variation	[27]
Leiomyosarcoma	DIS6COXM	Limited	Genetic Variation	[27]
Limb-mammary syndrome	DIS7H4FP	Limited	Genetic Variation	[27]
Melanoma	DIS1RRCY	Limited	Altered Expression	[28]
Metastatic melanoma	DISSL43L	Limited	Biomarker	[29]
Pancreatic cancer	DISJC981	Limited	Biomarker	[30]
Stomach cancer	DISKIJSX	Limited	Biomarker	[26]
Urinary bladder cancer	DISDV4T7	Limited	Biomarker	[25]
Urinary bladder neoplasm	DIS7HACE	Limited	Biomarker	[25]

This DOT Affected the Drug Response of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Fluorouracil	DMUM7HZ	Approved	Retrotransposon-derived protein PEG10 (PEG10) affects the response to substance of Fluorouracil.	[61]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the methylation of Retrotransposon-derived protein PEG10 (PEG10).	[31]
Triclosan	DMZUR4N	Approved	Triclosan increases the methylation of Retrotransposon-derived protein PEG10 (PEG10).	[41]

30 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Retrotransposon-derived protein PEG10 (PEG10).	[32]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Retrotransposon-derived protein PEG10 (PEG10).	[33]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Retrotransposon-derived protein PEG10 (PEG10).	[34]
Doxorubicin	DMVP5YE	Approved	Doxorubicin affects the expression of Retrotransposon-derived protein PEG10 (PEG10).	[35]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Retrotransposon-derived protein PEG10 (PEG10).	[36]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Retrotransposon-derived protein PEG10 (PEG10).	[32]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Retrotransposon-derived protein PEG10 (PEG10).	[37]
Quercetin	DM3NC4M	Approved	Quercetin decreases the expression of Retrotransposon-derived protein PEG10 (PEG10).	[38]
Vorinostat	DMWMPD4	Approved	Vorinostat increases the expression of Retrotransposon-derived protein PEG10 (PEG10).	[39]
Testosterone	DM7HUNW	Approved	Testosterone decreases the expression of Retrotransposon-derived protein PEG10 (PEG10).	[40]
Decitabine	DMQL8XJ	Approved	Decitabine affects the expression of Retrotransposon-derived protein PEG10 (PEG10).	[42]
Progesterone	DMUY35B	Approved	Progesterone decreases the expression of Retrotransposon-derived protein PEG10 (PEG10).	[43]
Troglitazone	DM3VFPD	Approved	Troglitazone decreases the expression of Retrotransposon-derived protein PEG10 (PEG10).	[44]
Azathioprine	DMMZSXQ	Approved	Azathioprine decreases the expression of Retrotransposon-derived protein PEG10 (PEG10).	[45]
Ethanol	DMDRQZU	Approved	Ethanol increases the expression of Retrotransposon-derived protein PEG10 (PEG10).	[46]
Malathion	DMXZ84M	Approved	Malathion increases the expression of Retrotransposon-derived protein PEG10 (PEG10).	[47]
Ethinyl estradiol	DMODJ40	Approved	Ethinyl estradiol affects the expression of Retrotransposon-derived protein PEG10 (PEG10).	[48]
Pioglitazone	DMKJ485	Approved	Pioglitazone increases the expression of Retrotransposon-derived protein PEG10 (PEG10).	[49]
Liothyronine	DM6IR3P	Approved	Liothyronine increases the expression of Retrotransposon-derived protein PEG10 (PEG10).	[50]
Genistein	DM0JETC	Phase 2/3	Genistein increases the expression of Retrotransposon-derived protein PEG10 (PEG10).	[51]
Belinostat	DM6OC53	Phase 2	Belinostat increases the expression of Retrotransposon-derived protein PEG10 (PEG10).	[52]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of Retrotransposon-derived protein PEG10 (PEG10).	[32]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Retrotransposon-derived protein PEG10 (PEG10).	[53]
Leflunomide	DMR8ONJ	Phase 1 Trial	Leflunomide decreases the expression of Retrotransposon-derived protein PEG10 (PEG10).	[54]
Geldanamycin	DMS7TC5	Discontinued in Phase 2	Geldanamycin increases the expression of Retrotransposon-derived protein PEG10 (PEG10).	[55]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the expression of Retrotransposon-derived protein PEG10 (PEG10).	[56]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A affects the expression of Retrotransposon-derived protein PEG10 (PEG10).	[57]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde decreases the expression of Retrotransposon-derived protein PEG10 (PEG10).	[58]
Sulforaphane	DMQY3L0	Investigative	Sulforaphane decreases the expression of Retrotransposon-derived protein PEG10 (PEG10).	[59]
Deguelin	DMXT7WG	Investigative	Deguelin decreases the expression of Retrotransposon-derived protein PEG10 (PEG10).	[60]

References

• [1] Emergence of a cell line with extreme hypodiploidy in blast crisis of chronic myelocytic leukemia.Blood. 1979 Apr;53(4):707-11.
• [2] PEG10 counteracts signaling pathways of TGF- and BMP to regulate growth, motility and invasion of SW1353 chondrosarcoma cells.J Bone Miner Metab. 2019 May;37(3):441-454. doi: 10.1007/s00774-018-0946-8. Epub 2018 Aug 9.
• [3] Isochromosome 21 and other chromosomal abnormalities in a patient with erythroleukaemia.Ann Genet. 1983;26(4):240-2.
• [4] PEG10 is associated with treatment-induced neuroendocrine prostate cancer.J Mol Endocrinol. 2019 Jul 1;63(1):39-49. doi: 10.1530/JME-18-0226.
• [5] Addressing the room for improvement in management of acute promyelocytic leukemia.Eur J Haematol. 2019 Jun;102(6):479-485. doi: 10.1111/ejh.13229. Epub 2019 Apr 7.
• [6] Expression analysis and mutation detection of DLX5 and DLX6 in autism.Brain Dev. 2010 Feb;32(2):98-104. doi: 10.1016/j.braindev.2008.12.021. Epub 2009 Feb 4.
• [7] PEG10 is a c-MYC target gene in cancer cells.Cancer Res. 2006 Jan 15;66(2):665-72. doi: 10.1158/0008-5472.CAN-05-1553.
• [8] The effects of Curcumin on HCT-116 cells proliferation and apoptosis via the miR-491/PEG10 pathway.J Cell Biochem. 2018 Apr;119(4):3091-3098. doi: 10.1002/jcb.26449. Epub 2018 Jan 15.
• [9] Long noncoding RNA PEG10 regulates proliferation and invasion of esophageal cancer cells.Cancer Gene Ther. 2015 Apr;22(3):138-44. doi: 10.1038/cgt.2014.77. Epub 2015 Jan 16.
• [10] Maternal prenatal depression is associated with decreased placental expression of the imprinted gene PEG3.Psychol Med. 2016 Oct;46(14):2999-3011. doi: 10.1017/S0033291716001598. Epub 2016 Aug 15.
• [11] Profiling differential microRNA expression between in situ, infiltrative and lympho-vascular space invasive breast cancer: a pilot study.Clin Exp Metastasis. 2018 Feb;35(1-2):3-13. doi: 10.1007/s10585-017-9868-4. Epub 2017 Dec 6.
• [12] Dysregulation of DNA methylation and expression of imprinted genes in mouse placentas of fetal growth restriction induced by maternal cadmium exposure.Toxicology. 2017 Sep 1;390:109-116. doi: 10.1016/j.tox.2017.08.003. Epub 2017 Aug 18.
• [13] Prediction of relapse and prognosis by expression levels of long noncoding RNA PEG10 in glioma patients.Medicine (Baltimore). 2019 Nov;98(45):e17583. doi: 10.1097/MD.0000000000017583.
• [14] TSG101 promotes the proliferation, migration and invasion of hepatocellular carcinoma cells by regulating the PEG10.J Cell Mol Med. 2019 Jan;23(1):70-82. doi: 10.1111/jcmm.13878. Epub 2018 Nov 18.
• [15] Overexpression of long noncoding RNA PEG10 promotes proliferation, invasion and metastasis of hypopharyngeal squamous cell carcinoma.Oncol Lett. 2017 Sep;14(3):2919-2925. doi: 10.3892/ol.2017.6498. Epub 2017 Jun 30.
• [16] Isolation of a new melanoma antigen, MART-2, containing a mutated epitope recognized by autologous tumor-infiltrating T lymphocytes.J Immunol. 2001 Feb 15;166(4):2871-7. doi: 10.4049/jimmunol.166.4.2871.
• [17] PEG10 Promoter-Driven Expression of Reporter Genes Enables Molecular Imaging of Lethal Prostate Cancer.Cancer Res. 2019 Nov 1;79(21):5668-5680. doi: 10.1158/0008-5472.CAN-19-2181. Epub 2019 Sep 17.
• [18] A bioinformatics-to-clinic sequential approach to analysis of prostate cancer biomarkers using TCGA datasets and clinical samples: a new method for precision oncology?.Oncotarget. 2017 Aug 24;8(59):99601-99611. doi: 10.18632/oncotarget.20448. eCollection 2017 Nov 21.
• [19] Identification of the potential biomarkers for the metastasis of rectal adenocarcinoma.APMIS. 2017 Feb;125(2):93-100. doi: 10.1111/apm.12633. Epub 2016 Dec 28.
• [20] Methylation profiling in individuals with Russell-Silver syndrome.Am J Med Genet A. 2010 Feb;152A(2):347-55. doi: 10.1002/ajmg.a.33204.
• [21] Overexpression of the paternally expressed gene 10 (PEG10) from the imprinted locus on chromosome 7q21 in high-risk B-cell chronic lymphocytic leukemia.Int J Cancer. 2007 Nov 1;121(9):1984-1993. doi: 10.1002/ijc.22929.
• [22] PEG10 plays a crucial role in human lung cancer proliferation, progression, prognosis and metastasis.Oncol Rep. 2014 Nov;32(5):2159-67. doi: 10.3892/or.2014.3469. Epub 2014 Sep 9.
• [23] Expression of Radioresistant Gene PEG10 in OSCC Patients and Its Prognostic Significance.Asian Pac J Cancer Prev. 2017 Jul 25;18(6):1513-1518. doi: 10.22034/APJCP.2017.18.6.1513.
• [24] Knockdown long non-coding RNA PEG10 inhibits proliferation, migration and invasion of glioma cell line U251 by regulating miR-506.Gen Physiol Biophys. 2019 Jul;38(4):295-304. doi: 10.4149/gpb_2019018. Epub 2019 Jun 26.
• [25] RETRACTED: lncRNA PEG10 promotes cell survival, invasion and migration by sponging miR-134 in human bladder cancer.Biomed Pharmacother. 2019 Jun;114:108814. doi: 10.1016/j.biopha.2019.108814. Epub 2019 Apr 4.
• [26] Knockdown of long non-coding RNA PEG10 inhibits growth, migration and invasion of gastric carcinoma cells via up-regulating miR-3200.Neoplasma. 2018 Sep 19;65(5):769-778. doi: 10.4149/neo_2018_171204N794. Epub 2018 Jun 17.
• [27] Cytogenetic analysis of a leiomyosarcoma of the kidney.Cancer Genet Cytogenet. 1994 Feb;72(2):126-9. doi: 10.1016/0165-4608(94)90127-9.
• [28] Declination of long noncoding RNA paternally expressed gene 10 inhibits A375 cells proliferation, migration, and invasion via mediating microRNA-33a.J Cell Biochem. 2019 Dec;120(12):19868-19877. doi: 10.1002/jcb.29292. Epub 2019 Jul 18.
• [29] Three-way and two-way rearrangements involving chromosomes 10, 2, 5 and 5, 2 in two marker chromosomes of a human melanoma cell line.Melanoma Res. 1994 Aug;4(4):259-65. doi: 10.1097/00008390-199408000-00008.
• [30] PEG10 overexpression induced by E2F-1 promotes cell proliferation, migration, and invasion in pancreatic cancer.J Exp Clin Cancer Res. 2017 Feb 13;36(1):30. doi: 10.1186/s13046-017-0500-x.
• [31] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [32] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [33] Effect of retinoic acid on gene expression in human conjunctival epithelium: secretory phospholipase A2 mediates retinoic acid induction of MUC16. Invest Ophthalmol Vis Sci. 2005 Nov;46(11):4050-61.
• [34] Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
• [35] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [36] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [37] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [38] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [39] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [40] The exosome-like vesicles derived from androgen exposed-prostate stromal cells promote epithelial cells proliferation and epithelial-mesenchymal transition. Toxicol Appl Pharmacol. 2021 Jan 15;411:115384. doi: 10.1016/j.taap.2020.115384. Epub 2020 Dec 25.
• [41] Pregnancy exposure to synthetic phenols and placental DNA methylation - An epigenome-wide association study in male infants from the EDEN cohort. Environ Pollut. 2021 Dec 1;290:118024. doi: 10.1016/j.envpol.2021.118024. Epub 2021 Aug 21.
• [42] Epigenetic silencing of novel tumor suppressors in malignant melanoma. Cancer Res. 2006 Dec 1;66(23):11187-93. doi: 10.1158/0008-5472.CAN-06-1274.
• [43] Effects of progesterone treatment on expression of genes involved in uterine quiescence. Reprod Sci. 2011 Aug;18(8):781-97.
• [44] Transcriptomic analysis of untreated and drug-treated differentiated HepaRG cells over a 2-week period. Toxicol In Vitro. 2015 Dec 25;30(1 Pt A):27-35.
• [45] A transcriptomics-based in vitro assay for predicting chemical genotoxicity in vivo. Carcinogenesis. 2012 Jul;33(7):1421-9.
• [46] Cardiac toxicity from ethanol exposure in human-induced pluripotent stem cell-derived cardiomyocytes. Toxicol Sci. 2019 May 1;169(1):280-292.
• [47] Exposure to Insecticides Modifies Gene Expression and DNA Methylation in Hematopoietic Tissues In Vitro. Int J Mol Sci. 2023 Mar 26;24(7):6259. doi: 10.3390/ijms24076259.
• [48] The genomic response of Ishikawa cells to bisphenol A exposure is dose- and time-dependent. Toxicology. 2010 Apr 11;270(2-3):137-49. doi: 10.1016/j.tox.2010.02.008. Epub 2010 Feb 17.
• [49] Peroxisome proliferator activated receptor gamma (PPAR-gama) ligand pioglitazone regulated gene networks in term human primary trophoblast cells. Reprod Toxicol. 2018 Oct;81:99-107.
• [50] Monitoring of deiodinase deficiency based on transcriptomic responses in SH-SY5Y cells. Arch Toxicol. 2013 Jun;87(6):1103-13. doi: 10.1007/s00204-013-1018-4. Epub 2013 Feb 10.
• [51] Genistein and bisphenol A exposure cause estrogen receptor 1 to bind thousands of sites in a cell type-specific manner. Genome Res. 2012 Nov;22(11):2153-62.
• [52] Gene expression-signature of belinostat in cell lines is specific for histone deacetylase inhibitor treatment, with a corresponding signature in xenografts. Anticancer Drugs. 2009 Sep;20(8):682-92.
• [53] BET bromodomain protein inhibition is a therapeutic option for medulloblastoma. Oncotarget. 2013 Nov;4(11):2080-95.
• [54] Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
• [55] Identification of transcriptome signatures and biomarkers specific for potential developmental toxicants inhibiting human neural crest cell migration. Arch Toxicol. 2016 Jan;90(1):159-80.
• [56] Bisphenol A Analogues Suppress Spheroid Attachment on Human Endometrial Epithelial Cells through Modulation of Steroid Hormone Receptors Signaling Pathway. Cells. 2021 Oct 26;10(11):2882. doi: 10.3390/cells10112882.
• [57] A trichostatin A expression signature identified by TempO-Seq targeted whole transcriptome profiling. PLoS One. 2017 May 25;12(5):e0178302. doi: 10.1371/journal.pone.0178302. eCollection 2017.
• [58] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
• [59] Transcriptome and DNA methylation changes modulated by sulforaphane induce cell cycle arrest, apoptosis, DNA damage, and suppression of proliferation in human liver cancer cells. Food Chem Toxicol. 2020 Feb;136:111047. doi: 10.1016/j.fct.2019.111047. Epub 2019 Dec 12.
• [60] Neurotoxicity and underlying cellular changes of 21 mitochondrial respiratory chain inhibitors. Arch Toxicol. 2021 Feb;95(2):591-615. doi: 10.1007/s00204-020-02970-5. Epub 2021 Jan 29.
• [61] Gene expression profiling of 30 cancer cell lines predicts resistance towards 11 anticancer drugs at clinically achieved concentrations. Int J Cancer. 2006 Apr 1;118(7):1699-712. doi: 10.1002/ijc.21570.