Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTXKY794)

• DOT Name: Sperm mitochondrial-associated cysteine-rich protein (SMCP)
• Gene Name: SMCP
• Related Disease:
  Non-insulin dependent diabetes
  Type-1/2 diabetes
  Acute lymphocytic leukaemia
  Acute myocardial infarction
  Anemia
  Arteriosclerosis
  Atherosclerosis
  Cardiac failure
  Childhood acute lymphoblastic leukemia
  Congestive heart failure
  Cushing disease
  Dementia
  Depression
  Freeman-Sheldon syndrome
  Insomnia
  Major depressive disorder
  Mixed anxiety and depressive disorder
  Nephropathy
  Psoriasis
  Restless legs syndrome
  Sleep disorder
  Thrombocytopenia
  Anxiety
  Anxiety disorder
  Chronic obstructive pulmonary disease
  Stroke
  Ullrich congenital muscular dystrophy 1A
  Melanoma
  Subarachnoid hemorrhage
  Advanced cancer
  Arrhythmia
  Bone osteosarcoma
  Cardiomyopathy
  Metastatic malignant neoplasm
  Migraine disorder
  Non-alcoholic steatohepatitis
  Osteoarthritis
  Osteosarcoma
  Post-traumatic stress disorder
• UniProt ID: MCSP_HUMAN
• Sequence:
  MCDQTKHSKCCPAKGNQCCPPQQNQCCQSKGNQCCPPKQNQCCQPKGSQCCPPKHNHCCQ
  PKPPCCIQARCCGLETKPEVSPLNMESEPNSPQTQDKGCQTQQQPHSPQNESRPSK
• Function: Involved in sperm motility. Its absence is associated with genetic background dependent male infertility. Infertility may be due to reduced sperm motility in the female reproductive tract and inability to penetrate the oocyte zona pellucida.
• Tissue Specificity: Testis. Is selectively expressed in the spermatids of seminiferous tubules.

Molecular Interaction Atlas (MIA) of This DOT

39 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Non-insulin dependent diabetes	DISK1O5Z	Definitive	Genetic Variation	[1]
Type-1/2 diabetes	DISIUHAP	Definitive	Biomarker	[1]
Acute lymphocytic leukaemia	DISPX75S	Strong	Biomarker	[2]
Acute myocardial infarction	DISE3HTG	Strong	Biomarker	[3]
Anemia	DISTVL0C	Strong	Biomarker	[4]
Arteriosclerosis	DISK5QGC	Strong	Genetic Variation	[5]
Atherosclerosis	DISMN9J3	Strong	Genetic Variation	[5]
Cardiac failure	DISDC067	Strong	Biomarker	[6]
Childhood acute lymphoblastic leukemia	DISJ5D6U	Strong	Biomarker	[2]
Congestive heart failure	DIS32MEA	Strong	Biomarker	[6]
Cushing disease	DISOG6P2	Strong	Altered Expression	[7]
Dementia	DISXL1WY	Strong	Biomarker	[8]
Depression	DIS3XJ69	Strong	Biomarker	[9]
Freeman-Sheldon syndrome	DIS7V9PS	Strong	Biomarker	[10]
Insomnia	DIS0AFR7	Strong	Biomarker	[11]
Major depressive disorder	DIS4CL3X	Strong	Genetic Variation	[12]
Mixed anxiety and depressive disorder	DISV809X	Strong	Genetic Variation	[13]
Nephropathy	DISXWP4P	Strong	Biomarker	[14]
Psoriasis	DIS59VMN	Strong	Genetic Variation	[15]
Restless legs syndrome	DISNWY00	Strong	Biomarker	[16]
Sleep disorder	DIS3JP1U	Strong	Biomarker	[17]
Thrombocytopenia	DISU61YW	Strong	Biomarker	[4]
Anxiety	DISIJDBA	moderate	Genetic Variation	[18]
Anxiety disorder	DISBI2BT	moderate	Genetic Variation	[18]
Chronic obstructive pulmonary disease	DISQCIRF	moderate	Biomarker	[19]
Stroke	DISX6UHX	moderate	Biomarker	[20]
Ullrich congenital muscular dystrophy 1A	DISFHHF0	moderate	Biomarker	[21]
Melanoma	DIS1RRCY	Disputed	Biomarker	[22]
Subarachnoid hemorrhage	DISI7I8Y	Disputed	Altered Expression	[23]
Advanced cancer	DISAT1Z9	Limited	Biomarker	[9]
Arrhythmia	DISFF2NI	Limited	Genetic Variation	[24]
Bone osteosarcoma	DIST1004	Limited	Biomarker	[25]
Cardiomyopathy	DISUPZRG	Limited	Biomarker	[26]
Metastatic malignant neoplasm	DIS86UK6	Limited	Biomarker	[25]
Migraine disorder	DISFCQTG	Limited	Biomarker	[27]
Non-alcoholic steatohepatitis	DIST4788	Limited	Genetic Variation	[28]
Osteoarthritis	DIS05URM	Limited	Genetic Variation	[29]
Osteosarcoma	DISLQ7E2	Limited	Biomarker	[25]
Post-traumatic stress disorder	DISHL1EY	Limited	Genetic Variation	[30]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Sperm mitochondrial-associated cysteine-rich protein (SMCP).	[31]

References

• [1] As Time Goes by: Anxiety Negatively Affects the Perceived Quality of Life in Patients With Type 2 Diabetes of Long Duration.Front Psychol. 2019 Jul 31;10:1779. doi: 10.3389/fpsyg.2019.01779. eCollection 2019.
• [2] Adult acute lymphoblastic leukemia phenotypes defined by monoclonal antibodies.Blood. 1985 Mar;65(3):730-5.
• [3] The role of different mechanical circulatory support devices and their timing of implantation on myocardial damage and mid-term recovery in acute myocardial infarction related cardiogenic shock.J Interv Cardiol. 2018 Dec;31(6):717-724. doi: 10.1111/joic.12569. Epub 2018 Nov 20.
• [4] Clinical and equipment-related factors associated with the adequate peripheral blood stem cell collection in autologous transplant at a tertiary cancer center in Kerala - A retrospective cohort study.Transfus Apher Sci. 2019 Aug;58(4):457-463. doi: 10.1016/j.transci.2019.05.007. Epub 2019 Jun 21.
• [5] Suppression of proatherogenic leukocyte interactions by MCS-18--Impact on advanced atherosclerosis in ApoE-deficient mice.Atherosclerosis. 2016 Feb;245:101-10. doi: 10.1016/j.atherosclerosis.2015.12.001. Epub 2015 Dec 15.
• [6] Third Annual Report From the ISHLT Mechanically Assisted Circulatory Support Registry: A comparison of centrifugal and axial continuous-flow left ventricular assist devices.J Heart Lung Transplant. 2019 Apr;38(4):352-363. doi: 10.1016/j.healun.2019.02.004.
• [7] Quality of life is significantly impaired in both secretory and non-functioning pituitary adenomas.Clin Endocrinol (Oxf). 2019 Mar;90(3):457-467. doi: 10.1111/cen.13915. Epub 2019 Jan 15.
• [8] Utilization, effect, and benefit of the individualized Meeting Centers Support Program for people with dementia and caregivers.Clin Interv Aging. 2019 Aug 26;14:1527-1553. doi: 10.2147/CIA.S212852. eCollection 2019.
• [9] Infertility and Health-Related Quality of Life in United States Women Veterans.J Womens Health (Larchmt). 2020 Mar;29(3):412-419. doi: 10.1089/jwh.2019.7798. Epub 2019 Nov 22.
• [10] Home-Based Exercise Enhances Health-Related Quality of Life in Persons With Spinal Cord Injury: ARandomized Controlled Trial.Arch Phys Med Rehabil. 2018 Oct;99(10):1998-2006.e1. doi: 10.1016/j.apmr.2018.05.008. Epub 2018 Jun 11.
• [11] Relationship between Sleep Disorders and Health Related Quality of Life-Results from the Georgia SOMNUS Study.Int J Environ Res Public Health. 2018 Jul 26;15(8):1588. doi: 10.3390/ijerph15081588.
• [12] Impact of pre-diagnosis depressive symptoms and health-related quality of life on treatment choice for ductal carcinoma in situ and stage I breast cancer in older women.Breast Cancer Res Treat. 2019 Feb;173(3):709-717. doi: 10.1007/s10549-018-5006-5. Epub 2018 Nov 8.
• [13] The influence of selected psychological variables on quality of life of chronically dialysed patients.Scand J Caring Sci. 2019 Dec;33(4):840-847. doi: 10.1111/scs.12680. Epub 2019 May 9.
• [14] The prevalence of depression and the association between depression and kidney function and health-related quality of life in elderly patients with chronic kidney disease: a multicenter cross-sectional study.Clin Interv Aging. 2019 May 15;14:905-913. doi: 10.2147/CIA.S203186. eCollection 2019.
• [15] Burden of chronic urticaria relative to psoriasis in five European countries.J Eur Acad Dermatol Venereol. 2018 Feb;32(2):282-290. doi: 10.1111/jdv.14584. Epub 2017 Oct 12.
• [16] Restless legs syndrome is associated with major comorbidities in a population of Danish blood donors.Sleep Med. 2018 May;45:124-131. doi: 10.1016/j.sleep.2018.02.007. Epub 2018 Mar 8.
• [17] Yoga Program for High-Grade Glioma Patients Undergoing Radiotherapy and Their Family Caregivers.Integr Cancer Ther. 2018 Jun;17(2):332-336. doi: 10.1177/1534735417689882. Epub 2017 Feb 2.
• [18] Relationships between coping, anxiety, depression and health-related quality of life in outpatients with substance use disorders: results of the SUBUSQOL study.Psychol Health Med. 2020 Feb;25(2):179-189. doi: 10.1080/13548506.2019.1679847. Epub 2019 Oct 17.
• [19] Pulmonary Rehabilitation Outcomes after Single or Double Lung Transplantation in Patients with Chronic Obstructive Pulmonary Disease or Interstitial Lung Disease.Respiration. 2017;94(2):178-185. doi: 10.1159/000477351. Epub 2017 Jun 10.
• [20] Intraarterial route increases the risk of cerebral lesions after mesenchymal cell administration in animal model of ischemia.Sci Rep. 2017 Jan 16;7:40758. doi: 10.1038/srep40758.
• [21] Altered expression of the MCSP/NG2 chondroitin sulfate proteoglycan in collagen VI deficiency.Mol Cell Neurosci. 2005 Nov;30(3):408-17. doi: 10.1016/j.mcn.2005.08.005.
• [22] Immunomagnetic-Enriched Subpopulations of Melanoma Circulating Tumour Cells (CTCs) Exhibit Distinct Transcriptome Profiles.Cancers (Basel). 2019 Jan 30;11(2):157. doi: 10.3390/cancers11020157.
• [23] Excessive release of endogenous neuropeptide Y into cerebrospinal fluid after treatment of spontaneous subarachnoid haemorrhage and its possible impact on self-reported neuropsychological performance - results of a prospective clinical pilot study on good-grade patients.Neurol Res. 2018 Dec;40(12):1001-1013. doi: 10.1080/01616412.2018.1508547. Epub 2018 Sep 14.
• [24] ECMO and Short-term Support for Cardiogenic Shock in Heart Failure.Curr Cardiol Rep. 2018 Aug 16;20(10):87. doi: 10.1007/s11886-018-1041-4.
• [25] Novel Triazole-Piperazine Hybrid Molecules Induce Apoptosis via Activation of the Mitochondrial Pathway and Exhibit Antitumor Efficacy in Osteosarcoma Xenograft Nude Mice Model.ACS Chem Biol. 2017 Mar 17;12(3):753-768. doi: 10.1021/acschembio.6b01007. Epub 2017 Jan 26.
• [26] Polymerase chain reaction amplification of three different Trypanosoma cruzi DNA sequences from human chagasic cardiac tissue.Am J Trop Med Hyg. 1998 Oct;59(4):563-70. doi: 10.4269/ajtmh.1998.59.563.
• [27] Patients' perspective on the burden of migraine in Europe: a cross-sectional analysis of survey data in France, Germany, Italy, Spain, and the United Kingdom.J Headache Pain. 2018 Sep 10;19(1):82. doi: 10.1186/s10194-018-0907-6.
• [28] Metformin ameliorates activation of hepatic stellate cells and hepatic fibrosis by succinate and GPR91 inhibition.Biochem Biophys Res Commun. 2018 Jan 22;495(4):2649-2656. doi: 10.1016/j.bbrc.2017.12.143. Epub 2017 Dec 24.
• [29] Influence of reduction quality on functional outcome and quality of life in treatment of tibial plafond fractures: a retrospective cohort study.BMC Musculoskelet Disord. 2019 Nov 13;20(1):534. doi: 10.1186/s12891-019-2932-2.
• [30] An Assessment of Long-Term Physical and Emotional Quality of Life of Persons Injured on 9/11/2001.Int J Environ Res Public Health. 2019 Mar 23;16(6):1054. doi: 10.3390/ijerph16061054.
• [31] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.