Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTXRQDYG)

• DOT Name: Coiled-coil domain-containing protein 6 (CCDC6)
• Synonyms: Papillary thyroid carcinoma-encoded protein; Protein H4
• Gene Name: CCDC6
• Related Disease:
  Acute myelogenous leukaemia
  Benign neoplasm
  Cerebellar ataxia
  Chromosomal disorder
  Endometrial carcinoma
  Epilepsy
  Epithelial ovarian cancer
  Estrogen-receptor positive breast cancer
  Goiter
  Graves disease
  Hashimoto thyroiditis
  Inflammatory bowel disease
  Lung adenocarcinoma
  Lung cancer
  Lung carcinoma
  Medullary thyroid gland carcinoma
  Medulloblastoma
  Multinodular goiter
  Non-small-cell lung cancer
  Pancreatic adenocarcinoma
  Prostate cancer
  Prostate carcinoma
  Squamous cell carcinoma
  Thyroid cancer
  Thyroid gland carcinoma
  Thyroid tumor
  Advanced cancer
  Colorectal carcinoma
  Cutaneous melanoma
  Melanoma
  Retinopathy
  Adenocarcinoma
  Adenoma
  Adult glioblastoma
  Alcohol dependence
  Bladder cancer
  Carcinoma
  Gastrointestinal stromal tumour
  Glioblastoma multiforme
  Hepatocellular carcinoma
  Malignant pleural mesothelioma
  Methicillin-resistant staphylococci infection
  Plasma cell myeloma
  Urinary bladder cancer
  Urinary bladder neoplasm
• UniProt ID: CCDC6_HUMAN
• Pfam ID: PF09755
• Sequence:
  MADSASESDTDGAGGNSSSSAAMQSSCSSTSGGGGGGGGGGGGGKSGGIVISPFRLEELT
  NRLASLQQENKVLKIELETYKLKCKALQEENRDLRKASVTIQARAEQEEEFISNTLFKKI
  QALQKEKETLAVNYEKEEEFLTNELSRKLMQLQHEKAELEQHLEQEQEFQVNKLMKKIKK
  LENDTISKQLTLEQLRREKIDLENTLEQEQEALVNRLWKRMDKLEAEKRILQEKLDQPVS
  APPSPRDISMEIDSPENMMRHIRFLKNEVERLKKQLRAAQLQHSEKMAQYLEEERHMREE
  NLRLQRKLQREMERREALCRQLSESESSLEMDDERYFNEMSAQGLRPRTVSSPIPYTPSP
  SSSRPISPGLSYASHTVGFTPPTSLTRAGMSYYNSPGLHVQHMGTSHGITRPSPRRSNSP
  DKFKRPTPPPSPNTQTPVQPPPPPPPPPMQPTVPSAATSQPTPSQHSAHPSSQP
• Tissue Specificity: Ubiquitously expressed.
• KEGG Pathway:
  Pathways in cancer (hsa05200)
  Thyroid cancer (hsa05216)

Molecular Interaction Atlas (MIA) of This DOT

45 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Acute myelogenous leukaemia	DISCSPTN	Strong	Genetic Variation	[1]
Benign neoplasm	DISDUXAD	Strong	Biomarker	[2]
Cerebellar ataxia	DIS9IRAV	Strong	Biomarker	[3]
Chromosomal disorder	DISM5BB5	Strong	Genetic Variation	[4]
Endometrial carcinoma	DISXR5CY	Strong	Genetic Variation	[5]
Epilepsy	DISBB28L	Strong	Genetic Variation	[6]
Epithelial ovarian cancer	DIS56MH2	Strong	Biomarker	[7]
Estrogen-receptor positive breast cancer	DIS1H502	Strong	Biomarker	[8]
Goiter	DISLCGI6	Strong	Biomarker	[9]
Graves disease	DISU4KOQ	Strong	Biomarker	[10]
Hashimoto thyroiditis	DIS77CDF	Strong	Genetic Variation	[11]
Inflammatory bowel disease	DISGN23E	Strong	Biomarker	[12]
Lung adenocarcinoma	DISD51WR	Strong	Biomarker	[13]
Lung cancer	DISCM4YA	Strong	Genetic Variation	[14]
Lung carcinoma	DISTR26C	Strong	Genetic Variation	[14]
Medullary thyroid gland carcinoma	DISHBL3K	Strong	Biomarker	[15]
Medulloblastoma	DISZD2ZL	Strong	Genetic Variation	[16]
Multinodular goiter	DISZQJH7	Strong	Genetic Variation	[17]
Non-small-cell lung cancer	DIS5Y6R9	Strong	Biomarker	[18]
Pancreatic adenocarcinoma	DISKHX7S	Strong	Biomarker	[19]
Prostate cancer	DISF190Y	Strong	Altered Expression	[20]
Prostate carcinoma	DISMJPLE	Strong	Altered Expression	[20]
Squamous cell carcinoma	DISQVIFL	Strong	Biomarker	[21]
Thyroid cancer	DIS3VLDH	Strong	Genetic Variation	[22]
Thyroid gland carcinoma	DISMNGZ0	Strong	Genetic Variation	[23]
Thyroid tumor	DISLVKMD	Strong	Genetic Variation	[22]
Advanced cancer	DISAT1Z9	moderate	Biomarker	[24]
Colorectal carcinoma	DIS5PYL0	moderate	Biomarker	[25]
Cutaneous melanoma	DIS3MMH9	moderate	Genetic Variation	[26]
Melanoma	DIS1RRCY	moderate	Genetic Variation	[26]
Retinopathy	DISB4B0F	moderate	Biomarker	[27]
Adenocarcinoma	DIS3IHTY	Limited	Biomarker	[28]
Adenoma	DIS78ZEV	Limited	Biomarker	[29]
Adult glioblastoma	DISVP4LU	Limited	Biomarker	[30]
Alcohol dependence	DIS4ZSCO	Limited	Biomarker	[31]
Bladder cancer	DISUHNM0	Limited	Biomarker	[32]
Carcinoma	DISH9F1N	Limited	Altered Expression	[33]
Gastrointestinal stromal tumour	DIS6TJYS	Limited	Altered Expression	[34]
Glioblastoma multiforme	DISK8246	Limited	Biomarker	[30]
Hepatocellular carcinoma	DIS0J828	Limited	Biomarker	[35]
Malignant pleural mesothelioma	DIST2R60	Limited	Biomarker	[36]
Methicillin-resistant staphylococci infection	DIS6DRDZ	Limited	Biomarker	[37]
Plasma cell myeloma	DIS0DFZ0	Limited	Biomarker	[38]
Urinary bladder cancer	DISDV4T7	Limited	Biomarker	[32]
Urinary bladder neoplasm	DIS7HACE	Limited	Biomarker	[32]

This DOT Affected the Drug Response of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Etoposide	DMNH3PG	Approved	Coiled-coil domain-containing protein 6 (CCDC6) decreases the response to substance of Etoposide.	[52]

10 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate affects the expression of Coiled-coil domain-containing protein 6 (CCDC6).	[39]
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Coiled-coil domain-containing protein 6 (CCDC6).	[40]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Coiled-coil domain-containing protein 6 (CCDC6).	[41]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Coiled-coil domain-containing protein 6 (CCDC6).	[42]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of Coiled-coil domain-containing protein 6 (CCDC6).	[43]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Coiled-coil domain-containing protein 6 (CCDC6).	[44]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide decreases the expression of Coiled-coil domain-containing protein 6 (CCDC6).	[46]
Bortezomib	DMNO38U	Approved	Bortezomib decreases the expression of Coiled-coil domain-containing protein 6 (CCDC6).	[47]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the expression of Coiled-coil domain-containing protein 6 (CCDC6).	[49]
chloropicrin	DMSGBQA	Investigative	chloropicrin decreases the expression of Coiled-coil domain-containing protein 6 (CCDC6).	[50]

4 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Arsenic	DMTL2Y1	Approved	Arsenic affects the methylation of Coiled-coil domain-containing protein 6 (CCDC6).	[45]
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 decreases the phosphorylation of Coiled-coil domain-containing protein 6 (CCDC6).	[48]
Coumarin	DM0N8ZM	Investigative	Coumarin decreases the phosphorylation of Coiled-coil domain-containing protein 6 (CCDC6).	[48]
Hexadecanoic acid	DMWUXDZ	Investigative	Hexadecanoic acid decreases the phosphorylation of Coiled-coil domain-containing protein 6 (CCDC6).	[51]

References

• [1] Thalidomide in Combination with Chemotherapy in Treating Elderly Patients with Acute Myeloid Leukemia.Oncol Res Treat. 2018;41(7-8):461-465. doi: 10.1159/000487804. Epub 2018 Jul 6.
• [2] Noninvasive Follicular Variant of Papillary Thyroid Carcinoma and the Afirma Gene-Expression Classifier.Thyroid. 2016 Jul;26(7):911-5. doi: 10.1089/thy.2015.0644.
• [3] Involvement of H4(D10S170) protein in ATM-dependent response to DNA damage.Oncogene. 2007 Sep 13;26(42):6167-75. doi: 10.1038/sj.onc.1210446. Epub 2007 Apr 9.
• [4] Follicular variant of papillary thyroid carcinoma: genome-wide appraisal of a controversial entity.Genes Chromosomes Cancer. 2004 Aug;40(4):355-64. doi: 10.1002/gcc.20049.
• [5] Triple Angiokinase Inhibitor Nintedanib Directly Inhibits Tumor Cell Growth and Induces Tumor Shrinkage via Blocking Oncogenic Receptor Tyrosine Kinases.J Pharmacol Exp Ther. 2018 Mar;364(3):494-503. doi: 10.1124/jpet.117.244129. Epub 2017 Dec 20.
• [6] Genetic epidemiology of epilepsy: a twin study.Neurol India. 2005 Mar;53(1):93-8. doi: 10.4103/0028-3886.15070.
• [7] Evaluating the Mechanism and Therapeutic Potential of PTC-028, a Novel Inhibitor of BMI-1 Function in Ovarian Cancer.Mol Cancer Ther. 2018 Jan;17(1):39-49. doi: 10.1158/1535-7163.MCT-17-0574. Epub 2017 Nov 20.
• [8] The rearranged during transfection/papillary thyroid carcinoma tyrosine kinase is an estrogen-dependent gene required for the growth of estrogen receptor positive breast cancer cells.Breast Cancer Res Treat. 2012 Jun;133(2):487-500. doi: 10.1007/s10549-011-1775-9. Epub 2011 Sep 24.
• [9] Circulating ctDNA methylation quantification of two DNA methyl transferases in papillary thyroid carcinoma.J Cell Biochem. 2019 Oct;120(10):17422-17437. doi: 10.1002/jcb.29007. Epub 2019 May 24.
• [10] INSL-3 is expressed in human hyperplastic and neoplastic thyrocytes.Int J Oncol. 2003 May;22(5):993-1001.
• [11] Upregulation Of Protein Tyrosine Phosphatase Receptor Type C Associates To The Combination Of Hashimoto's Thyroiditis And Papillary Thyroid Carcinoma And Is Predictive Of A Poor Prognosis.Onco Targets Ther. 2019 Oct 14;12:8479-8489. doi: 10.2147/OTT.S226426. eCollection 2019.
• [12] Tuftsin phosphorylcholine-a novel compound harnessing helminths to fight autoimmunity.Immunol Res. 2018 Dec;66(6):637-641. doi: 10.1007/s12026-018-9051-2.
• [13] Identification of a lung adenocarcinoma cell line with CCDC6-RET fusion gene and the effect of RET inhibitors in vitro and in vivo.Cancer Sci. 2013 Jul;104(7):896-903. doi: 10.1111/cas.12175. Epub 2013 May 12.
• [14] The rationale for druggability of CCDC6-tyrosine kinase fusions in lung cancer.Mol Cancer. 2018 Feb 19;17(1):46. doi: 10.1186/s12943-018-0799-8.
• [15] Multiple HABP2 variants in familial papillary thyroid carcinoma: Contribution of a group of "thyroid-checked" controls.Eur J Med Genet. 2017 Mar;60(3):178-184. doi: 10.1016/j.ejmg.2017.01.001. Epub 2017 Jan 9.
• [16] Genetics of brain tumors.Curr Opin Pediatr. 2000 Dec;12(6):543-8. doi: 10.1097/00008480-200012000-00005.
• [17] Molecular Testing for Oncogenic Gene Alterations in Pediatric Thyroid Lesions.Thyroid. 2018 Jan;28(1):60-67. doi: 10.1089/thy.2017.0059. Epub 2017 Dec 11.
• [18] Successful long-term treatment of non-small cell lung cancer positive for RET rearrangement with pemetrexed.Onco Targets Ther. 2019 Jul 8;12:5355-5358. doi: 10.2147/OTT.S211582. eCollection 2019.
• [19] Cytological evaluation by fine needle aspiration biopsy of incidental focal increased fluorodeoxyglucose uptake in thyroid on positron emission tomography scan.Diagn Cytopathol. 2017 Jun;45(6):501-506. doi: 10.1002/dc.23695. Epub 2017 Mar 6.
• [20] The combined effect of USP7 inhibitors and PARP inhibitors in hormone-sensitive and castration-resistant prostate cancer cells.Oncotarget. 2017 May 9;8(19):31815-31829. doi: 10.18632/oncotarget.16463.
• [21] Pharmacological inhibition of Bmi1 by PTC-209 impaired tumor growth in head neck squamous cell carcinoma.Cancer Cell Int. 2017 Nov 21;17:107. doi: 10.1186/s12935-017-0481-z. eCollection 2017.
• [22] Selected single-nucleotide polymorphisms in FOXE1, SERPINA5, FTO, EVPL, TICAM1 and SCARB1 are associated with papillary and follicular thyroid cancer risk: replication study in a German population.Carcinogenesis. 2016 Jul;37(7):677-684. doi: 10.1093/carcin/bgw047. Epub 2016 Apr 28.
• [23] ETV6-NTRK3 and STRN-ALK kinase fusions are recurrent events in papillary thyroid cancer of adult population.Eur J Endocrinol. 2018 Jan;178(1):83-91. doi: 10.1530/EJE-17-0499. Epub 2017 Oct 18.
• [24] PD-L1 and thyroid cytology: A possible diagnostic and prognostic marker.Cancer Cytopathol. 2020 Mar;128(3):177-189. doi: 10.1002/cncy.22224. Epub 2019 Dec 10.
• [25] RET fusions observed in lung and colorectal cancers are sensitive to ponatinib.Oncotarget. 2018 Jul 3;9(51):29654-29664. doi: 10.18632/oncotarget.25664. eCollection 2018 Jul 3.
• [26] Synchronous occurrence of medullary and papillary carcinoma of the thyroid in a patient with cutaneous melanoma: determination of BRAFV600E in peripheral blood and tissues. Report of a case and review of the literature.Endocr Pathol. 2014 Sep;25(3):324-31. doi: 10.1007/s12022-014-9303-1.
• [27] Functional rescue of REP1 following treatment with PTC124 and novel derivative PTC-414 in human choroideremia fibroblasts and the nonsense-mediated zebrafish model.Hum Mol Genet. 2016 Aug 15;25(16):3416-3431. doi: 10.1093/hmg/ddw184. Epub 2016 Jun 21.
• [28] RET, ROS1 and ALK fusions in lung cancer.Nat Med. 2012 Feb 12;18(3):378-81. doi: 10.1038/nm.2658.
• [29] Overexpression of the S-phase kinase-associated protein 2 in thyroid cancer.Endocr Relat Cancer. 2007 Jun;14(2):405-20. doi: 10.1677/ERC-06-0030.
• [30] Targeting of BMI-1 with PTC-209 inhibits glioblastoma development.Cell Cycle. 2018;17(10):1199-1211. doi: 10.1080/15384101.2018.1469872. Epub 2018 Jul 23.
• [31] Associations of phenylthiocarbamide tasting to alcohol problems and family history of alcoholism differ by gender.Psychiatry Res. 2006 Jun 30;143(1):21-7. doi: 10.1016/j.psychres.2005.07.029. Epub 2006 May 18.
• [32] CCDC6 and USP7 expression levels suggest novel treatment options in high-grade urothelial bladder cancer.J Exp Clin Cancer Res. 2019 Feb 20;38(1):90. doi: 10.1186/s13046-019-1087-1.
• [33] Mutual regulation of TGF-1, TRII and ErbB receptors expression in human thyroid carcinomas.Exp Cell Res. 2014 Sep 10;327(1):24-36. doi: 10.1016/j.yexcr.2014.06.012. Epub 2014 Jun 26.
• [34] A systems biological approach to identify key transcription factors and their genomic neighborhoods in human sarcomas.Chin J Cancer. 2011 Jan;30(1):27-40. doi: 10.5732/cjc.010.10541.
• [35] HOXA-AS2 Promotes Proliferation and Induces Epithelial-Mesenchymal Transition via the miR-520c-3p/GPC3 Axis in Hepatocellular Carcinoma.Cell Physiol Biochem. 2018;50(6):2124-2138. doi: 10.1159/000495056. Epub 2018 Nov 9.
• [36] Analysis of CCDC6 as a novel biomarker for the clinical use of PARP1 inhibitors in malignant pleural mesothelioma.Lung Cancer. 2019 Sep;135:56-65. doi: 10.1016/j.lungcan.2019.07.011. Epub 2019 Jul 13.
• [37] Prevalence and Genetic Characteristics of Methicillin-Resistant Staphylococcus aureus and Coagulase-Negative Staphylococci Isolated from Oral Cavity of Healthy Children in Japan.Microb Drug Resist. 2019 Apr;25(3):400-407. doi: 10.1089/mdr.2018.0333. Epub 2019 Jan 29.
• [38] The polycomb group protein BMI-1 inhibitor PTC-209 is a potent anti-myeloma agent alone or in combination with epigenetic inhibitors targeting EZH2 and the BET bromodomains.Oncotarget. 2017 Oct 20;8(61):103731-103743. doi: 10.18632/oncotarget.21909. eCollection 2017 Nov 28.
• [39] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [40] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [41] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [42] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [43] Low doses of cisplatin induce gene alterations, cell cycle arrest, and apoptosis in human promyelocytic leukemia cells. Biomark Insights. 2016 Aug 24;11:113-21.
• [44] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [45] Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
• [46] Oxidative stress modulates theophylline effects on steroid responsiveness. Biochem Biophys Res Commun. 2008 Dec 19;377(3):797-802.
• [47] The proapoptotic effect of zoledronic acid is independent of either the bone microenvironment or the intrinsic resistance to bortezomib of myeloma cells and is enhanced by the combination with arsenic trioxide. Exp Hematol. 2011 Jan;39(1):55-65.
• [48] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [49] Bisphenol A Exposure Changes the Transcriptomic and Proteomic Dynamics of Human Retinoblastoma Y79 Cells. Genes (Basel). 2021 Feb 11;12(2):264. doi: 10.3390/genes12020264.
• [50] Transcriptomic analysis of human primary bronchial epithelial cells after chloropicrin treatment. Chem Res Toxicol. 2015 Oct 19;28(10):1926-35.
• [51] Functional lipidomics: Palmitic acid impairs hepatocellular carcinoma development by modulating membrane fluidity and glucose metabolism. Hepatology. 2017 Aug;66(2):432-448. doi: 10.1002/hep.29033. Epub 2017 Jun 16.
• [52] Loss of CCDC6 affects cell cycle through impaired intra-S-phase checkpoint control. PLoS One. 2012;7(2):e31007. doi: 10.1371/journal.pone.0031007. Epub 2012 Feb 17.