Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTXX61VZ)

DOT Name Electron transfer flavoprotein subunit alpha, mitochondrial (ETFA)
Synonyms Alpha-ETF
Gene Name ETFA
Related Disease
Multiple acyl-CoA dehydrogenase deficiency ( )
Nephropathy ( )
Non-insulin dependent diabetes ( )
Thyroid cancer ( )
Thyroid gland carcinoma ( )
Thyroid tumor ( )
Type-1 diabetes ( )
B-cell lymphoma ( )
Bladder cancer ( )
Breast cancer ( )
Breast carcinoma ( )
Breast neoplasm ( )
Carcinoma ( )
Central nervous system neoplasm ( )
Depression ( )
Epithelial ovarian cancer ( )
Glioblastoma multiforme ( )
Glioma ( )
Herpes simplex infection ( )
Irritable bowel syndrome ( )
Lung cancer ( )
Lung carcinoma ( )
Mesothelioma ( )
Metastatic melanoma ( )
Multiple sclerosis ( )
Myelodysplastic syndrome ( )
Neuroblastoma ( )
Non-small-cell lung cancer ( )
Obesity ( )
Ovarian cancer ( )
Ovarian neoplasm ( )
Plasma cell myeloma ( )
Psoriasis ( )
Schizophrenia ( )
Urinary bladder cancer ( )
Urinary bladder neoplasm ( )
Adenocarcinoma ( )
Spinal muscular atrophy ( )
Hepatitis C virus infection ( )
Hepatocellular carcinoma ( )
Invasive aspergillosis ( )
Melanoma ( )
Osteoarthritis ( )
Rheumatoid arthritis ( )
Squamous cell carcinoma ( )
UniProt ID
ETFA_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
1EFV; 1T9G; 2A1T; 2A1U
Pfam ID
PF01012 ; PF00766
Sequence
MFRAAAPGQLRRAASLLRFQSTLVIAEHANDSLAPITLNTITAATRLGGEVSCLVAGTKC
DKVAQDLCKVAGIAKVLVAQHDVYKGLLPEELTPLILATQKQFNYTHICAGASAFGKNLL
PRVAAKLEVAPISDIIAIKSPDTFVRTIYAGNALCTVKCDEKVKVFSVRGTSFDAAATSG
GSASSEKASSTSPVEISEWLDQKLTKSDRPELTGAKVVVSGGRGLKSGENFKLLYDLADQ
LHAAVGASRAAVDAGFVPNDMQVGQTGKIVAPELYIAVGISGAIQHLAGMKDSKTIVAIN
KDPEAPIFQVADYGIVADLFKVVPEMTEILKKK
Function
Heterodimeric electron transfer flavoprotein that accepts electrons from several mitochondrial dehydrogenases, including acyl-CoA dehydrogenases, glutaryl-CoA and sarcosine dehydrogenase. It transfers the electrons to the main mitochondrial respiratory chain via ETF-ubiquinone oxidoreductase (ETF dehydrogenase). Required for normal mitochondrial fatty acid oxidation and normal amino acid metabolism.
Reactome Pathway
Respiratory electron transport (R-HSA-611105 )

Molecular Interaction Atlas (MIA) of This DOT

45 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Multiple acyl-CoA dehydrogenase deficiency DISEFBN7 Definitive Autosomal recessive [1]
Nephropathy DISXWP4P Definitive Genetic Variation [2]
Non-insulin dependent diabetes DISK1O5Z Definitive Biomarker [3]
Thyroid cancer DIS3VLDH Definitive Biomarker [4]
Thyroid gland carcinoma DISMNGZ0 Definitive Biomarker [4]
Thyroid tumor DISLVKMD Definitive Biomarker [4]
Type-1 diabetes DIS7HLUB Definitive Biomarker [5]
B-cell lymphoma DISIH1YQ Strong Biomarker [6]
Bladder cancer DISUHNM0 Strong Biomarker [7]
Breast cancer DIS7DPX1 Strong Biomarker [8]
Breast carcinoma DIS2UE88 Strong Biomarker [8]
Breast neoplasm DISNGJLM Strong Biomarker [9]
Carcinoma DISH9F1N Strong Biomarker [10]
Central nervous system neoplasm DISFC18W Strong Genetic Variation [11]
Depression DIS3XJ69 Strong Genetic Variation [12]
Epithelial ovarian cancer DIS56MH2 Strong Genetic Variation [13]
Glioblastoma multiforme DISK8246 Strong Genetic Variation [14]
Glioma DIS5RPEH Strong Biomarker [15]
Herpes simplex infection DISL1SAV Strong Biomarker [16]
Irritable bowel syndrome DIS27206 Strong Biomarker [5]
Lung cancer DISCM4YA Strong Biomarker [17]
Lung carcinoma DISTR26C Strong Biomarker [17]
Mesothelioma DISKWK9M Strong Biomarker [18]
Metastatic melanoma DISSL43L Strong Biomarker [19]
Multiple sclerosis DISB2WZI Strong Biomarker [20]
Myelodysplastic syndrome DISYHNUI Strong Genetic Variation [21]
Neuroblastoma DISVZBI4 Strong Genetic Variation [22]
Non-small-cell lung cancer DIS5Y6R9 Strong Biomarker [23]
Obesity DIS47Y1K Strong Genetic Variation [24]
Ovarian cancer DISZJHAP Strong Genetic Variation [13]
Ovarian neoplasm DISEAFTY Strong Genetic Variation [13]
Plasma cell myeloma DIS0DFZ0 Strong Biomarker [25]
Psoriasis DIS59VMN Strong Biomarker [26]
Schizophrenia DISSRV2N Strong Genetic Variation [24]
Urinary bladder cancer DISDV4T7 Strong Biomarker [7]
Urinary bladder neoplasm DIS7HACE Strong Biomarker [7]
Adenocarcinoma DIS3IHTY moderate Altered Expression [27]
Spinal muscular atrophy DISTLKOB moderate Biomarker [28]
Hepatitis C virus infection DISQ0M8R Limited Biomarker [29]
Hepatocellular carcinoma DIS0J828 Limited Biomarker [30]
Invasive aspergillosis DISAI029 Limited Biomarker [31]
Melanoma DIS1RRCY Limited Biomarker [32]
Osteoarthritis DIS05URM Limited Biomarker [33]
Rheumatoid arthritis DISTSB4J Limited Biomarker [34]
Squamous cell carcinoma DISQVIFL Limited Biomarker [35]
------------------------------------------------------------------------------------
⏷ Show the Full List of 45 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
2 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the methylation of Electron transfer flavoprotein subunit alpha, mitochondrial (ETFA). [36]
PMID28870136-Compound-52 DMFDERP Patented PMID28870136-Compound-52 decreases the phosphorylation of Electron transfer flavoprotein subunit alpha, mitochondrial (ETFA). [47]
------------------------------------------------------------------------------------
12 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Ciclosporin DMAZJFX Approved Ciclosporin decreases the expression of Electron transfer flavoprotein subunit alpha, mitochondrial (ETFA). [37]
Acetaminophen DMUIE76 Approved Acetaminophen decreases the expression of Electron transfer flavoprotein subunit alpha, mitochondrial (ETFA). [38]
Doxorubicin DMVP5YE Approved Doxorubicin decreases the expression of Electron transfer flavoprotein subunit alpha, mitochondrial (ETFA). [39]
Ivermectin DMDBX5F Approved Ivermectin decreases the expression of Electron transfer flavoprotein subunit alpha, mitochondrial (ETFA). [40]
Arsenic trioxide DM61TA4 Approved Arsenic trioxide increases the expression of Electron transfer flavoprotein subunit alpha, mitochondrial (ETFA). [41]
Vorinostat DMWMPD4 Approved Vorinostat increases the expression of Electron transfer flavoprotein subunit alpha, mitochondrial (ETFA). [42]
Fenofibrate DMFKXDY Approved Fenofibrate increases the expression of Electron transfer flavoprotein subunit alpha, mitochondrial (ETFA). [43]
Napabucasin DMDZ6Q3 Phase 3 Napabucasin decreases the expression of Electron transfer flavoprotein subunit alpha, mitochondrial (ETFA). [44]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the expression of Electron transfer flavoprotein subunit alpha, mitochondrial (ETFA). [45]
PMID28460551-Compound-2 DM4DOUB Patented PMID28460551-Compound-2 decreases the expression of Electron transfer flavoprotein subunit alpha, mitochondrial (ETFA). [46]
Bisphenol A DM2ZLD7 Investigative Bisphenol A increases the expression of Electron transfer flavoprotein subunit alpha, mitochondrial (ETFA). [48]
chloropicrin DMSGBQA Investigative chloropicrin affects the expression of Electron transfer flavoprotein subunit alpha, mitochondrial (ETFA). [49]
------------------------------------------------------------------------------------
⏷ Show the Full List of 12 Drug(s)

References

1 Technical standards for the interpretation and reporting of constitutional copy-number variants: a joint consensus recommendation of the American College of Medical Genetics and Genomics (ACMG) and the Clinical Genome Resource (ClinGen). Genet Med. 2020 Feb;22(2):245-257. doi: 10.1038/s41436-019-0686-8. Epub 2019 Nov 6.
2 Multi-organ abnormalities and mTORC1 activation in zebrafish model of multiple acyl-CoA dehydrogenase deficiency.PLoS Genet. 2013 Jun;9(6):e1003563. doi: 10.1371/journal.pgen.1003563. Epub 2013 Jun 13.
3 Promising cardiovascular and blood pressure effects of the SGLT2 inhibitors: a new class of antidiabetic drugs.Drugs Today (Barc). 2017 Mar;53(3):191-202. doi: 10.1358/dot.2017.53.3.2555985.
4 Safety Profiles and Pharmacovigilance Considerations for Recently Patented Anticancer Drugs: Advanced Thyroid Cancer.Recent Pat Anticancer Drug Discov. 2019;14(3):226-241. doi: 10.2174/1574892814666190726143011.
5 Coeliac disease.Paediatr Int Child Health. 2019 Feb;39(1):23-31. doi: 10.1080/20469047.2018.1504431. Epub 2018 Aug 13.
6 CD30 (Ki-1)-positive malignant lymphomas: clinical, immunophenotypic, histologic, and genetic characteristics and differences with Hodgkin's disease.Blood. 1996 Apr 1;87(7):2905-17.
7 Bladder cancer initiating cells (BCICs) are among EMA-CD44v6+ subset: novel methods for isolating undetermined cancer stem (initiating) cells.Cancer Invest. 2008 Aug;26(7):725-33. doi: 10.1080/07357900801941845.
8 Evaluating triptorelin as a treatment option for breast cancer.Expert Opin Pharmacother. 2019 Oct;20(15):1809-1818. doi: 10.1080/14656566.2019.1650020. Epub 2019 Sep 9.
9 CDK4 phosphorylation status and a linked gene expression profile predict sensitivity to palbociclib.EMBO Mol Med. 2017 Aug;9(8):1052-1066. doi: 10.15252/emmm.201607084.
10 t(6;11) renal cell carcinoma (RCC): expanded immunohistochemical profile emphasizing novel RCC markers and report of 10 new genetically confirmed cases.Am J Surg Pathol. 2014 May;38(5):604-14. doi: 10.1097/PAS.0000000000000203.
11 Genome-wide association study of glioma subtypes identifies specific differences in genetic susceptibility to glioblastoma and non-glioblastoma tumors.Nat Genet. 2017 May;49(5):789-794. doi: 10.1038/ng.3823. Epub 2017 Mar 27.
12 Systematic analysis of circadian genes in a population-based sample reveals association of TIMELESS with depression and sleep disturbance.PLoS One. 2010 Feb 18;5(2):e9259. doi: 10.1371/journal.pone.0009259.
13 Delivering widespread BRCA testing and PARP inhibition to patients with ovarian cancer.Nat Rev Clin Oncol. 2017 May;14(5):284-296. doi: 10.1038/nrclinonc.2016.191. Epub 2016 Dec 13.
14 Genome-wide association study identifies multiple susceptibility loci for glioma.Nat Commun. 2015 Oct 1;6:8559. doi: 10.1038/ncomms9559.
15 Additional evidence supports association of common genetic variants in VTI1A and ETFA with increased risk of glioma susceptibility.J Neurol Sci. 2017 Apr 15;375:282-288. doi: 10.1016/j.jns.2017.02.013. Epub 2017 Feb 8.
16 High response rates for T-VEC in early metastatic melanoma (stage IIIB/C-IVM1a).Int J Cancer. 2019 Aug 15;145(4):974-978. doi: 10.1002/ijc.32172. Epub 2019 Feb 21.
17 Profile of entrectinib and its potential in the treatment of ROS1-positive NSCLC: evidence to date.Lung Cancer (Auckl). 2019 Sep 9;10:87-94. doi: 10.2147/LCTT.S190786. eCollection 2019.
18 Cytologic Differential Diagnosis of Malignant Mesothelioma and Reactive Mesothelial Cells With FISH Analysis of p16.Diagn Cytopathol. 2016 Jul;44(7):591-8. doi: 10.1002/dc.23490. Epub 2016 Apr 15.
19 Efficacy of Vemurafenib Treatment in 43 Metastatic Melanoma Patients with BRAF Mutation. Single-Institute Retrospective Analysis, Early Real-Life Survival Data.Pathol Oncol Res. 2019 Jan;25(1):45-50. doi: 10.1007/s12253-017-0324-1. Epub 2017 Sep 29.
20 Cladribine - an old newcomer for pulsed immune reconstitution in MS.Nat Rev Neurol. 2017 Oct;13(10):573-574. doi: 10.1038/nrneurol.2017.119. Epub 2017 Sep 8.
21 Epoetin alfa for the treatment of myelodysplastic syndrome-related anemia: A review of clinical data, clinical guidelines, and treatment protocols.Leuk Res. 2019 Jun;81:35-42. doi: 10.1016/j.leukres.2019.03.006. Epub 2019 Mar 27.
22 Rhabdomyosarcoma of the head and neck in children.Oral Oncol. 2002 Jul;38(5):450-9. doi: 10.1016/s1368-8375(01)00105-1.
23 Programmed death ligand 1 immunohistochemistry in non-small cell lung carcinoma.J Thorac Dis. 2019 Jan;11(Suppl 1):S89-S101. doi: 10.21037/jtd.2018.12.103.
24 Statistical Binning for Barcoded Reads Improves Downstream Analyses.Cell Syst. 2018 Aug 22;7(2):219-226.e5. doi: 10.1016/j.cels.2018.07.005.
25 Panobinostat for the Treatment of Multiple Myeloma.Clin Cancer Res. 2015 Nov 1;21(21):4767-73. doi: 10.1158/1078-0432.CCR-15-0530. Epub 2015 Sep 11.
26 Guselkumab for the treatment of adults with moderate to severe plaque psoriasis.Expert Rev Clin Immunol. 2019 Jun;15(6):589-597. doi: 10.1080/1744666X.2019.1601014. Epub 2019 Apr 12.
27 Biological characterization of two xenografts derived from human CUPs (carcinomas of unknown primary).BMC Cancer. 2007 Dec 18;7:225. doi: 10.1186/1471-2407-7-225.
28 Genetic neuromuscular disorders: living the era of a therapeutic revolution. Part 2: diseases of motor neuron and skeletal muscle.Neurol Sci. 2019 Apr;40(4):671-681. doi: 10.1007/s10072-019-03764-z. Epub 2019 Feb 25.
29 Glecaprevir/Pibrentasvir: First Global Approval.Drugs. 2017 Oct;77(16):1797-1804. doi: 10.1007/s40265-017-0817-y.
30 Hepatocellular carcinoma-associated protein markers investigated by MALDI-TOF MS.Mol Med Rep. 2010 Jul-Aug;3(4):589-96. doi: 10.3892/mmr_00000302.
31 Isavuconazole: A new broad-spectrum azole. Part 2: pharmacokinetics and clinical activity.J Mycol Med. 2018 Mar;28(1):15-22. doi: 10.1016/j.mycmed.2018.02.002. Epub 2018 Mar 16.
32 Ipilimumab in melanoma.Expert Rev Anticancer Ther. 2016 Aug;16(8):811-26. doi: 10.1080/14737140.2016.1211936. Epub 2016 Jul 25.
33 Mitochondrial dysregulation of osteoarthritic human articular chondrocytes analyzed by proteomics: a decrease in mitochondrial superoxide dismutase points to a redox imbalance.Mol Cell Proteomics. 2009 Jan;8(1):172-89. doi: 10.1074/mcp.M800292-MCP200. Epub 2008 Sep 9.
34 Comparative Price Analysis of Biological Products for Treatment of Rheumatoid Arthritis.Front Pharmacol. 2018 Sep 20;9:1070. doi: 10.3389/fphar.2018.01070. eCollection 2018.
35 Could EMA and cytokeratin 7 be useful in distinguishing tricholemmal carcinoma from clear-cell squamous cell carcinoma? A case series from our department and a brief review of the literature.Acta Histochem. 2019 Aug;121(6):765-767. doi: 10.1016/j.acthis.2019.06.002. Epub 2019 Jun 21.
36 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
37 Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
38 Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
39 Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
40 Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
41 Chronic occupational exposure to arsenic induces carcinogenic gene signaling networks and neoplastic transformation in human lung epithelial cells. Toxicol Appl Pharmacol. 2012 Jun 1;261(2):204-16.
42 Proteomic analysis of liver cancer cells treated with suberonylanilide hydroxamic acid. Cancer Chemother Pharmacol. 2008 Apr;61(5):791-802.
43 Transcriptomic analysis of untreated and drug-treated differentiated HepaRG cells over a 2-week period. Toxicol In Vitro. 2015 Dec 25;30(1 Pt A):27-35.
44 Suppression of cancer relapse and metastasis by inhibiting cancer stemness. Proc Natl Acad Sci U S A. 2015 Feb 10;112(6):1839-44. doi: 10.1073/pnas.1424171112. Epub 2015 Jan 20.
45 Identification of a transcriptomic signature of food-relevant genotoxins in human HepaRG hepatocarcinoma cells. Food Chem Toxicol. 2020 Jun;140:111297. doi: 10.1016/j.fct.2020.111297. Epub 2020 Mar 28.
46 Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
47 Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
48 Low-dose Bisphenol A exposure alters the functionality and cellular environment in a human cardiomyocyte model. Environ Pollut. 2023 Oct 15;335:122359. doi: 10.1016/j.envpol.2023.122359. Epub 2023 Aug 9.
49 Transcriptomic analysis of human primary bronchial epithelial cells after chloropicrin treatment. Chem Res Toxicol. 2015 Oct 19;28(10):1926-35.