Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTY6X6BL)

• DOT Name: Kinesin-like protein KIF22 (KIF22)
• Synonyms: Kinesin-like DNA-binding protein; Kinesin-like protein 4
• Gene Name: KIF22
• Related Disease:
  Anxiety disorder
  Lung neoplasm
  Spondyloepimetaphyseal dysplasia with multiple dislocations
  Thyroid cancer
  Thyroid gland carcinoma
  Thyroid tumor
  Bipolar disorder
  Bladder cancer
  Bone osteosarcoma
  Breast cancer
  Breast carcinoma
  Clear cell renal carcinoma
  Colonic neoplasm
  Colorectal carcinoma
  Epilepsy
  Head and neck cancer
  Head and neck carcinoma
  Head-neck squamous cell carcinoma
  Hepatocellular carcinoma
  Immunodeficiency
  Inflammatory bowel disease
  KID syndrome
  Lung cancer
  Lung carcinoma
  Malignant soft tissue neoplasm
  Medulloblastoma
  Neoplasm
  Non-syndromic ichthyosis
  Osteosarcoma
  Prostate cancer
  Prostate neoplasm
  Renal cell carcinoma
  Rhabdomyosarcoma
  Sarcoma
  Spondyloepimetaphyseal dysplasia with joint laxity
  Urinary bladder cancer
  Urinary bladder neoplasm
  Osteochondrodysplasia
  Prostate carcinoma
  Skeletal dysplasia
  Small-cell lung cancer
  Spondyloepimetaphyseal dysplasia
  Non-small-cell lung cancer
  Keratitis
  Mesothelioma
  Triple negative breast cancer
• UniProt ID: KIF22_HUMAN
• PDB ID: 2EDU; 6NJE
• Pfam ID: PF12836 ; PF00225
• Sequence:
  MAAGGSTQQRRREMAAASAAAISGAGRCRLSKIGATRRPPPARVRVAVRLRPFVDGTAGA
  SDPPCVRGMDSCSLEIANWRNHQETLKYQFDAFYGERSTQQDIYAGSVQPILRHLLEGQN
  ASVLAYGPTGAGKTHTMLGSPEQPGVIPRALMDLLQLTREEGAEGRPWALSVTMSYLEIY
  QEKVLDLLDPASGDLVIREDCRGNILIPGLSQKPISSFADFERHFLPASRNRTVGATRLN
  QRSSRSHAVLLVKVDQRERLAPFRQREGKLYLIDLAGSEDNRRTGNKGLRLKESGAINTS
  LFVLGKVVDALNQGLPRVPYRDSKLTRLLQDSLGGSAHSILIANIAPERRFYLDTVSALN
  FAARSKEVINRPFTNESLQPHALGPVKLSQKELLGPPEAKRARGPEEEEIGSPEPMAAPA
  SASQKLSPLQKLSSMDPAMLERLLSLDRLLASQGSQGAPLLSTPKRERMVLMKTVEEKDL
  EIERLKTKQKELEAKMLAQKAEEKENHCPTMLRPLSHRTVTGAKPLKKAVVMPLQLIQEQ
  AASPNAEIHILKNKGRKRKLESLDALEPEEKAEDCWELQISPELLAHGRQKILDLLNEGS
  ARDLRSLQRIGPKKAQLIVGWRELHGPFSQVEDLERVEGITGKQMESFLKANILGLAAGQ
  RCGAS
• Function: Kinesin family member that is involved in spindle formation and the movements of chromosomes during mitosis and meiosis. Binds to microtubules and to DNA. Plays a role in congression of laterally attached chromosomes in NDC80-depleted cells.
• Tissue Specificity: Expressed in bone, cartilage, joint capsule, ligament, skin, and primary cultured chondrocytes.
• KEGG Pathway:
  Motor proteins (hsa04814)
  Progesterone-mediated oocyte maturation (hsa04914)
• Reactome Pathway:
  COPI-dependent Golgi-to-ER retrograde traffic (R-HSA-6811434)
  Kinesins (R-HSA-983189)
  MHC class II antigen presentation (R-HSA-2132295)

Molecular Interaction Atlas (MIA) of This DOT

46 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Anxiety disorder	DISBI2BT	Definitive	Biomarker	[1]
Lung neoplasm	DISVARNB	Definitive	Biomarker	[2]
Spondyloepimetaphyseal dysplasia with multiple dislocations	DISBNIZ6	Definitive	Autosomal dominant	[3]
Thyroid cancer	DIS3VLDH	Definitive	Biomarker	[4]
Thyroid gland carcinoma	DISMNGZ0	Definitive	Biomarker	[4]
Thyroid tumor	DISLVKMD	Definitive	Biomarker	[4]
Bipolar disorder	DISAM7J2	Strong	Biomarker	[5]
Bladder cancer	DISUHNM0	Strong	Biomarker	[6]
Bone osteosarcoma	DIST1004	Strong	Biomarker	[7]
Breast cancer	DIS7DPX1	Strong	Biomarker	[8]
Breast carcinoma	DIS2UE88	Strong	Biomarker	[8]
Clear cell renal carcinoma	DISBXRFJ	Strong	Biomarker	[9]
Colonic neoplasm	DISSZ04P	Strong	Genetic Variation	[10]
Colorectal carcinoma	DIS5PYL0	Strong	Biomarker	[11]
Epilepsy	DISBB28L	Strong	Genetic Variation	[12]
Head and neck cancer	DISBPSQZ	Strong	Biomarker	[13]
Head and neck carcinoma	DISOU1DS	Strong	Biomarker	[13]
Head-neck squamous cell carcinoma	DISF7P24	Strong	Biomarker	[14]
Hepatocellular carcinoma	DIS0J828	Strong	Biomarker	[15]
Immunodeficiency	DIS093I0	Strong	Altered Expression	[16]
Inflammatory bowel disease	DISGN23E	Strong	Biomarker	[17]
KID syndrome	DISRBJLW	Strong	Biomarker	[18]
Lung cancer	DISCM4YA	Strong	Biomarker	[19]
Lung carcinoma	DISTR26C	Strong	Biomarker	[19]
Malignant soft tissue neoplasm	DISTC6NO	Strong	Biomarker	[20]
Medulloblastoma	DISZD2ZL	Strong	Biomarker	[21]
Neoplasm	DISZKGEW	Strong	Biomarker	[22]
Non-syndromic ichthyosis	DISZ9QBQ	Strong	Biomarker	[18]
Osteosarcoma	DISLQ7E2	Strong	Biomarker	[7]
Prostate cancer	DISF190Y	Strong	Biomarker	[23]
Prostate neoplasm	DISHDKGQ	Strong	Genetic Variation	[24]
Renal cell carcinoma	DISQZ2X8	Strong	Biomarker	[9]
Rhabdomyosarcoma	DISNR7MS	Strong	Biomarker	[25]
Sarcoma	DISZDG3U	Strong	Biomarker	[20]
Spondyloepimetaphyseal dysplasia with joint laxity	DIS94DW9	Strong	Genetic Variation	[3]
Urinary bladder cancer	DISDV4T7	Strong	Biomarker	[6]
Urinary bladder neoplasm	DIS7HACE	Strong	Biomarker	[6]
Osteochondrodysplasia	DIS9SPWW	moderate	Biomarker	[3]
Prostate carcinoma	DISMJPLE	moderate	Biomarker	[23]
Skeletal dysplasia	DIS5Z8U6	moderate	Biomarker	[3]
Small-cell lung cancer	DISK3LZD	moderate	Genetic Variation	[26]
Spondyloepimetaphyseal dysplasia	DISO4L5A	moderate	Genetic Variation	[27]
Non-small-cell lung cancer	DIS5Y6R9	Disputed	Altered Expression	[28]
Keratitis	DISMFOEI	Limited	Biomarker	[29]
Mesothelioma	DISKWK9M	Limited	Biomarker	[30]
Triple negative breast cancer	DISAMG6N	Limited	Biomarker	[31]

12 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Kinesin-like protein KIF22 (KIF22).	[32]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Kinesin-like protein KIF22 (KIF22).	[33]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Kinesin-like protein KIF22 (KIF22).	[34]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Kinesin-like protein KIF22 (KIF22).	[35]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Kinesin-like protein KIF22 (KIF22).	[36]
Bortezomib	DMNO38U	Approved	Bortezomib decreases the expression of Kinesin-like protein KIF22 (KIF22).	[37]
Lucanthone	DMZLBUO	Approved	Lucanthone decreases the expression of Kinesin-like protein KIF22 (KIF22).	[38]
Dihydrotestosterone	DM3S8XC	Phase 4	Dihydrotestosterone increases the expression of Kinesin-like protein KIF22 (KIF22).	[39]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Kinesin-like protein KIF22 (KIF22).	[42]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Kinesin-like protein KIF22 (KIF22).	[44]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A affects the expression of Kinesin-like protein KIF22 (KIF22).	[45]
geraniol	DMS3CBD	Investigative	geraniol decreases the expression of Kinesin-like protein KIF22 (KIF22).	[46]

4 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Kinesin-like protein KIF22 (KIF22).	[40]
TAK-243	DM4GKV2	Phase 1	TAK-243 increases the sumoylation of Kinesin-like protein KIF22 (KIF22).	[41]
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 decreases the phosphorylation of Kinesin-like protein KIF22 (KIF22).	[43]
Coumarin	DM0N8ZM	Investigative	Coumarin increases the phosphorylation of Kinesin-like protein KIF22 (KIF22).	[43]

References

• [1] Prevalence and determinants of anxiety disorders among adolescents in a rural community from northern India.Asian J Psychiatr. 2019 Jun;43:137-142. doi: 10.1016/j.ajp.2019.05.009. Epub 2019 May 3.
• [2] KIF22 coordinates CAR and EGFR dynamics to promote cancer cell proliferation.Sci Signal. 2018 Jan 30;11(515):eaaq1060. doi: 10.1126/scisignal.aaq1060.
• [3] Recurrent dominant mutations affecting two adjacent residues in the motor domain of the monomeric kinesin KIF22 result in skeletal dysplasia and joint laxity. Am J Hum Genet. 2011 Dec 9;89(6):767-72. doi: 10.1016/j.ajhg.2011.10.016.
• [4] Comprehensive Exploration to Identify Predictive DNA Markers of Np63/SOX2 in Drug Resistance in Human Esophageal Squamous Cell Carcinoma.Ann Surg Oncol. 2019 Dec;26(13):4814-4825. doi: 10.1245/s10434-019-07795-w. Epub 2019 Sep 16.
• [5] White matter - emotion processing activity relationships in youth offspring of bipolar parents.J Affect Disord. 2019 Jan 15;243:153-164. doi: 10.1016/j.jad.2018.09.010. Epub 2018 Sep 11.
• [6] A Histone Deacetylase Inhibitor, OBP-801, and Celecoxib Synergistically Inhibit the Cell Growth with Apoptosis via a DR5-Dependent Pathway in Bladder Cancer Cells.Mol Cancer Ther. 2016 Sep;15(9):2066-75. doi: 10.1158/1535-7163.MCT-16-0010. Epub 2016 Jul 12.
• [7] Role of zoledronic acid in oncolytic virotherapy: Promotion of antitumor effect and prevention of bone destruction.Cancer Sci. 2017 Sep;108(9):1870-1880. doi: 10.1111/cas.13316. Epub 2017 Aug 3.
• [8] A novel approach using telomerase-specific replication-selective adenovirus for detection of circulating tumor cells in breast cancer patients.Breast Cancer Res Treat. 2011 Aug;128(3):765-73. doi: 10.1007/s10549-011-1603-2. Epub 2011 Jun 1.
• [9] A novel HDAC inhibitor OBP-801 and a PI3K inhibitor LY294002 synergistically induce apoptosis via the suppression of survivin and XIAP in renal cell carcinoma.Int J Oncol. 2013 Oct;43(4):1080-6. doi: 10.3892/ijo.2013.2042. Epub 2013 Jul 30.
• [10] Visualization of intrathoracically disseminated solid tumors in mice with optical imaging by telomerase-specific amplification of a transferred green fluorescent protein gene.Cancer Res. 2004 Sep 1;64(17):6259-65. doi: 10.1158/0008-5472.CAN-04-1335.
• [11] Comparison of the demographic characteristics of pediatric and adult colorectal cancer patients: a national inpatient sample based analysis.World J Pediatr. 2019 Feb;15(1):37-41. doi: 10.1007/s12519-018-0187-x. Epub 2018 Sep 27.
• [12] Assessment of the neuropsychiatric comorbidities in Chinese children with epilepsy using the MINI-KID tool.Epilepsy Res. 2018 Feb;140:8-14. doi: 10.1016/j.eplepsyres.2017.11.011. Epub 2017 Nov 24.
• [13] Use of telomelysin (OBP-301) in mouse xenografts of human head and neck cancer.Oncol Rep. 2009 Nov;22(5):1039-43. doi: 10.3892/or_00000533.
• [14] Telomerase-specific oncolytic adenovirus: antitumor effects on radiation-resistant head and neck squamous cell carcinoma cells.Head Neck. 2014 Mar;36(3):411-8. doi: 10.1002/hed.23309. Epub 2013 Jun 1.
• [15] Selective metastatic tumor labeling with green fluorescent protein and killing by systemic administration of telomerase-dependent adenoviruses.Mol Cancer Ther. 2009 Nov;8(11):3001-8. doi: 10.1158/1535-7163.MCT-09-0556. Epub 2009 Nov 3.
• [16] Telomerase-specific virotherapy in an animal model of human head and neck cancer.Mol Cancer Ther. 2009 Jan;8(1):171-7. doi: 10.1158/1535-7163.MCT-08-0620.
• [17] Response pattern analysis of IBD-KID: A knowledge assessment tool for children with inflammatory bowel disease.J Paediatr Child Health. 2020 Jan;56(1):155-162. doi: 10.1111/jpc.14547. Epub 2019 Jun 26.
• [18] Neurotological and neuroanatomical changes in the connexin-26-related HID/KID syndrome.Audiol Neurootol. 2006;11(4):242-8. doi: 10.1159/000093110. Epub 2006 May 4.
• [19] Enhanced antitumor efficacy of telomerase-specific oncolytic adenovirus with valproic acid against human cancer cells.Cancer Gene Ther. 2012 Nov;19(11):767-72. doi: 10.1038/cgt.2012.57. Epub 2012 Sep 7.
• [20] Preclinical evaluation of telomerase-specific oncolytic virotherapy for human bone and soft tissue sarcomas.Clin Cancer Res. 2011 Apr 1;17(7):1828-38. doi: 10.1158/1078-0432.CCR-10-2066. Epub 2011 Feb 16.
• [21] Cognitive deficits and psychopathological symptoms among children with medulloblastoma.Eur J Cancer Care (Engl). 2018 Nov;27(6):e12912. doi: 10.1111/ecc.12912. Epub 2018 Sep 11.
• [22] Suppression of KIF22 Inhibits Cell Proliferation and Xenograft Tumor Growth in Colon Cancer.Cancer Biother Radiopharm. 2020 Feb;35(1):50-57. doi: 10.1089/cbr.2019.3045. Epub 2019 Oct 29.
• [23] High Expression of KIF22/Kinesin-Like DNA Binding Protein (Kid) as a Poor Prognostic Factor in Prostate Cancer Patients.Med Sci Monit. 2018 Nov 14;24:8190-8197. doi: 10.12659/MSM.912643.
• [24] Direct and distant antitumor effects of a telomerase-selective oncolytic adenoviral agent, OBP-301, in a mouse prostate cancer model.Cancer Gene Ther. 2008 May;15(5):315-22. doi: 10.1038/cgt.2008.3. Epub 2008 Feb 15.
• [25] [Erratum] OBP?01, a novel histone deacetylase inhibitor, induces Mphase arrest and apoptosis in rhabdomyosarcoma cells.Oncol Rep. 2019 Apr;41(4):2601. doi: 10.3892/or.2019.6997. Epub 2019 Feb 1.
• [26] Detection and preliminary evaluation of circulating tumor cells in the peripheral blood of patients with eight types of cancer using a telomerase-specific adenovirus.Oncol Rep. 2014 Nov;32(5):1772-8. doi: 10.3892/or.2014.3436. Epub 2014 Aug 22.
• [27] A novel multiple joint dislocation syndrome associated with a homozygous nonsense variant in the EXOC6B gene. Eur J Hum Genet. 2016 Aug;24(8):1206-10. doi: 10.1038/ejhg.2015.261. Epub 2015 Dec 16.
• [28] Histone deacetylase inhibitor FR901228 enhances the antitumor effect of telomerase-specific replication-selective adenoviral agent OBP-301 in human lung cancer cells.Exp Cell Res. 2006 Feb 1;312(3):256-65. doi: 10.1016/j.yexcr.2005.10.026. Epub 2005 Dec 13.
• [29] Design and Characterization of a Human Monoclonal Antibody that Modulates Mutant Connexin 26 Hemichannels Implicated in Deafness and Skin Disorders.Front Mol Neurosci. 2017 Sep 22;10:298. doi: 10.3389/fnmol.2017.00298. eCollection 2017.
• [30] A novel translational approach for human malignant pleural mesothelioma: heparanase-assisted dual virotherapy.Oncogene. 2010 Feb 25;29(8):1145-54. doi: 10.1038/onc.2009.415. Epub 2009 Nov 23.
• [31] The histone deacetylase inhibitor OBP-801 and eribulin synergistically inhibit the growth of triple-negative breast cancer cells with the suppression of survivin, Bcl-xL, and the MAPK pathway.Breast Cancer Res Treat. 2018 Aug;171(1):43-52. doi: 10.1007/s10549-018-4815-x. Epub 2018 May 11.
• [32] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [33] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [34] Effect of retinoic acid on gene expression in human conjunctival epithelium: secretory phospholipase A2 mediates retinoic acid induction of MUC16. Invest Ophthalmol Vis Sci. 2005 Nov;46(11):4050-61.
• [35] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [36] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [37] The proapoptotic effect of zoledronic acid is independent of either the bone microenvironment or the intrinsic resistance to bortezomib of myeloma cells and is enhanced by the combination with arsenic trioxide. Exp Hematol. 2011 Jan;39(1):55-65.
• [38] Lucanthone is a novel inhibitor of autophagy that induces cathepsin D-mediated apoptosis. J Biol Chem. 2011 Feb 25;286(8):6602-13.
• [39] LSD1 activates a lethal prostate cancer gene network independently of its demethylase function. Proc Natl Acad Sci U S A. 2018 May 1;115(18):E4179-E4188.
• [40] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [41] Inhibiting ubiquitination causes an accumulation of SUMOylated newly synthesized nuclear proteins at PML bodies. J Biol Chem. 2019 Oct 18;294(42):15218-15234. doi: 10.1074/jbc.RA119.009147. Epub 2019 Jul 8.
• [42] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [43] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [44] Bisphenol A induces DSB-ATM-p53 signaling leading to cell cycle arrest, senescence, autophagy, stress response, and estrogen release in human fetal lung fibroblasts. Arch Toxicol. 2018 Apr;92(4):1453-1469.
• [45] A trichostatin A expression signature identified by TempO-Seq targeted whole transcriptome profiling. PLoS One. 2017 May 25;12(5):e0178302. doi: 10.1371/journal.pone.0178302. eCollection 2017.
• [46] Geraniol suppresses prostate cancer growth through down-regulation of E2F8. Cancer Med. 2016 Oct;5(10):2899-2908.