Details of the Drug

General Information of Drug (ID: DM59JCN)

Drug Name

Drotrecogin alfa

Synonyms

Xigris; Drotrecogin alfa (activated); Xigris (TN); Drotrecogin alfa (activated) (USAN)

Indication

Disease Entry	ICD 11	Status	REF
Cerebrovascular ischaemia	8B1Z	Approved	[1]
Severe sepsis	1G40-1G41	Approved	[1]
------------------------------------------------------------------------------------

Therapeutic Class

Antisepsis Agents

Sequence

>heavy chain
LIDGKMTRRGDSPWQVVLLDSKKKLACGAVLIHPSWVLTAAHCMDESKKLLVRLGEYDLR
RWEKWELDLDIKEVFVHPNYSKSTTDNDIALLHLAQPATLSQTIVPICLPDSGLAERELN
QAGQETLVTGWGYHSSREKEAKRNRTFVLNFIKIPVVPHNECSEVMSNMVSENMLCAGIL
GDRQDACEGDSGGPMVASFHGTWFLVGLVSWGEGCGLLHNYGVYTKVSRYLDWIHGHIRD
KEAPQKSWAP
>light chain
SKHVDGDQCLVLPLEHPCASLCCGHGTCIXGIGSFSCDCRSGWEGRFCQREVSFLNCSLD
NGGCTHYCLEEVGWRRCSCAPGYKLGDDLLQCHPAVKFPCGRPWKRMEKKRSHL

ADMET Property

Half-life: The concentration or amount of drug in body reduced by one-half in 5.5 hours [2]

Cross-matching ID

DrugBank ID: DB00055
TTD ID: D0PG0G

Repurposed Drugs (RPD)

Click to Jump to the Detailed RPD Information of This Drug

Molecular Interaction Atlas of This Drug

Drug Therapeutic Target (DTT)

DTT Name	DTT ID	UniProt ID	MOA	REF
Coagulation factor Va (F5)	TT1O264	FA5_HUMAN	Inhibitor	[3]
Coagulation factor VIII (F8)	TT1290U	FA8_HUMAN	Inhibitor	[3]

------------------------------------------------------------------------------------

Molecular Interaction Atlas (MIA)

MIA Detail

Jump to Detail Molecular Interaction Atlas of This Drug

Molecular Expression Atlas of This Drug

The Studied Disease

Cerebrovascular ischaemia

ICD Disease Classification

8B1Z

Molecule Name	Molecule Type	Gene Name	p-value	Fold-Change	Z-score
Coagulation factor Va (F5)	DTT	F5	2.14E-37	1.93	2.54
Coagulation factor VIII (F8)	DTT	F8	1.08E-22	0.89	1.82

Molecular Expression Atlas (MEA)

MEA Detail

Jump to Detail Molecular Expression Atlas of This Drug

Drug-Drug Interaction (DDI) Information of This Drug

Coadministration of a Drug Treating the Disease Different from Drotrecogin alfa (Comorbidity)

DDI Drug Name	DDI Drug ID	Severity	Mechanism	Comorbidity	REF
Inotersen	DMJ93CT	Major	Increased risk of bleeding by the combination of Drotrecogin alfa and Inotersen.	Amyloidosis [5D00]	[4]
Eptifibatide	DMQXTJS	Major	Increased risk of bleeding by the combination of Drotrecogin alfa and Eptifibatide.	Angina pectoris [BA40]	[4]
Cilostazol	DMZMSCT	Major	Increased risk of bleeding by the combination of Drotrecogin alfa and Cilostazol.	Arterial occlusive disease [BD40]	[4]
Trastuzumab Emtansine	DMU1LXS	Major	Increased risk of bleeding by the combination of Drotrecogin alfa and Trastuzumab Emtansine.	Breast cancer [2C60-2C6Y]	[4]
Vitamin E	DMZC90K	Moderate	Increased risk of bleeding by the combination of Drotrecogin alfa and Vitamin E.	Cardiovascular disease [BA00-BE2Z]	[5]
Pentosan polysulfate	DM2HRKE	Moderate	Increased risk of bleeding by the combination of Drotrecogin alfa and Pentosan polysulfate.	Chronic pain [MG30]	[6]
Phenylbutazone	DMAYL0T	Major	Increased risk of bleeding by the combination of Drotrecogin alfa and Phenylbutazone.	Chronic pain [MG30]	[4]
Ketoprofen	DMRKXPT	Major	Increased risk of bleeding by the combination of Drotrecogin alfa and Ketoprofen.	Chronic pain [MG30]	[4]
Levomilnacipran	DMV26S8	Moderate	Increased risk of bleeding by the combination of Drotrecogin alfa and Levomilnacipran.	Chronic pain [MG30]	[7]
Anisindione	DM2C48U	Major	Increased risk of bleeding by the combination of Drotrecogin alfa and Anisindione.	Coagulation defect [3B10]	[4]
Regorafenib	DMHSY1I	Major	Increased risk of bleeding by the combination of Drotrecogin alfa and Regorafenib.	Colorectal cancer [2B91]	[4]
Intedanib	DMSTA36	Major	Increased risk of bleeding by the combination of Drotrecogin alfa and Intedanib.	Colorectal cancer [2B91]	[4]
Ardeparin	DMYRX8B	Major	Increased risk of bleeding by the combination of Drotrecogin alfa and Ardeparin.	Coronary thrombosis [BA43]	[8]
Danaparoid	DM6CLBN	Major	Increased risk of bleeding by the combination of Drotrecogin alfa and Danaparoid.	Deep vein thrombosis [BD71]	[8]
Rivaroxaban	DMQMBZ1	Major	Increased risk of bleeding by the combination of Drotrecogin alfa and Rivaroxaban.	Deep vein thrombosis [BD71]	[4]
Sertraline	DM0FB1J	Moderate	Increased risk of bleeding by the combination of Drotrecogin alfa and Sertraline.	Depression [6A70-6A7Z]	[7]
Fluoxetine	DM3PD2C	Moderate	Increased risk of bleeding by the combination of Drotrecogin alfa and Fluoxetine.	Depression [6A70-6A7Z]	[7]
Vilazodone	DM4LECQ	Moderate	Increased risk of bleeding by the combination of Drotrecogin alfa and Vilazodone.	Depression [6A70-6A7Z]	[7]
Paroxetine	DM5PVQE	Moderate	Increased risk of bleeding by the combination of Drotrecogin alfa and Paroxetine.	Depression [6A70-6A7Z]	[7]
Vortioxetine	DM6F1PU	Moderate	Increased risk of bleeding by the combination of Drotrecogin alfa and Vortioxetine.	Depression [6A70-6A7Z]	[7]
Duloxetine	DM9BI7M	Moderate	Increased risk of bleeding by the combination of Drotrecogin alfa and Duloxetine.	Depression [6A70-6A7Z]	[7]
Milnacipran	DMBFE74	Moderate	Increased risk of bleeding by the combination of Drotrecogin alfa and Milnacipran.	Depression [6A70-6A7Z]	[7]
Escitalopram	DMFK9HG	Moderate	Increased risk of bleeding by the combination of Drotrecogin alfa and Escitalopram.	Depression [6A70-6A7Z]	[7]
Desvenlafaxine	DMHD4PE	Moderate	Increased risk of bleeding by the combination of Drotrecogin alfa and Desvenlafaxine.	Depression [6A70-6A7Z]	[7]
Clomipramine	DMINRKW	Moderate	Increased risk of bleeding by the combination of Drotrecogin alfa and Clomipramine.	Depression [6A70-6A7Z]	[7]
Fluvoxamine	DMQTJSX	Moderate	Increased risk of bleeding by the combination of Drotrecogin alfa and Fluvoxamine.	Depression [6A70-6A7Z]	[7]
Venlafaxine	DMR6QH0	Moderate	Increased risk of bleeding by the combination of Drotrecogin alfa and Venlafaxine.	Depression [6A70-6A7Z]	[7]
Heme	DMGC287	Moderate	Increased risk of bleeding by the combination of Drotrecogin alfa and Heme.	Discovery agent [N.A.]	[9]
Apigenin	DMI3491	Minor	Increased risk of bleeding by the combination of Drotrecogin alfa and Apigenin.	Discovery agent [N.A.]	[10]
Citalopram derivative 1	DMITX1G	Moderate	Increased risk of bleeding by the combination of Drotrecogin alfa and Citalopram derivative 1.	Discovery agent [N.A.]	[7]
PMID28870136-Compound-49	DMTUC9E	Moderate	Increased risk of bleeding by the combination of Drotrecogin alfa and PMID28870136-Compound-49.	Discovery agent [N.A.]	[11]
Fenfluramine	DM0762O	Moderate	Increased risk of bleeding by the combination of Drotrecogin alfa and Fenfluramine.	Epilepsy/seizure [8A61-8A6Z]	[7]
Suprofen	DMKXJZ7	Moderate	Increased risk of bleeding by the combination of Drotrecogin alfa and Suprofen.	Eye anterior segment structural developmental anomaly [LA11]	[12]
Mefenamic acid	DMK7HFI	Major	Increased risk of bleeding by the combination of Drotrecogin alfa and Mefenamic acid.	Female pelvic pain [GA34]	[4]
Avapritinib	DMK2GZX	Major	Increased risk of bleeding by the combination of Drotrecogin alfa and Avapritinib.	Gastrointestinal stromal tumour [2B5B]	[4]
Sulfinpyrazone	DMEV954	Major	Increased risk of bleeding by the combination of Drotrecogin alfa and Sulfinpyrazone.	Gout [FA25]	[4]
Tipranavir	DM8HJX6	Major	Increased risk of bleeding by the combination of Drotrecogin alfa and Tipranavir.	Human immunodeficiency virus disease [1C60-1C62]	[13]
Dipyridamole	DMXY30O	Major	Increased risk of bleeding by the combination of Drotrecogin alfa and Dipyridamole.	Hypertension [BA00-BA04]	[4]
Meclofenamic acid	DM05FXR	Major	Increased risk of bleeding by the combination of Drotrecogin alfa and Meclofenamic acid.	Inflammatory spondyloarthritis [FA92]	[4]
Ticlopidine	DMO946V	Major	Increased risk of bleeding by the combination of Drotrecogin alfa and Ticlopidine.	Ischaemic/haemorrhagic stroke [8B20]	[4]
Tositumomab	DMMYZ3D	Major	Increased risk of bleeding by the combination of Drotrecogin alfa and Tositumomab.	Malignant haematopoietic neoplasm [2B33]	[14]
Acalabrutinib	DM7GCVW	Major	Increased risk of bleeding by the combination of Drotrecogin alfa and Acalabrutinib.	Mature B-cell lymphoma [2A85]	[4]
Ibrutinib	DMHZCPO	Major	Increased risk of bleeding by the combination of Drotrecogin alfa and Ibrutinib.	Mature B-cell lymphoma [2A85]	[4]
Ponatinib	DMYGJQO	Major	Increased risk of bleeding by the combination of Drotrecogin alfa and Ponatinib.	Mature B-cell lymphoma [2A85]	[4]
Arry-162	DM1P6FR	Major	Increased risk of bleeding by the combination of Drotrecogin alfa and Arry-162.	Melanoma [2C30]	[4]
LGX818	DMNQXV8	Major	Increased risk of bleeding by the combination of Drotrecogin alfa and LGX818.	Melanoma [2C30]	[4]
Panobinostat	DM58WKG	Major	Increased risk of bleeding by the combination of Drotrecogin alfa and Panobinostat.	Multiple myeloma [2A83]	[4]
Fedratinib	DM4ZBK6	Major	Increased risk of bleeding by the combination of Drotrecogin alfa and Fedratinib.	Myeloproliferative neoplasm [2A20]	[4]
Ruxolitinib	DM7Q98D	Major	Increased risk of bleeding by the combination of Drotrecogin alfa and Ruxolitinib.	Myeloproliferative neoplasm [2A20]	[4]
Dasatinib	DMJV2EK	Major	Increased risk of bleeding by the combination of Drotrecogin alfa and Dasatinib.	Myeloproliferative neoplasm [2A20]	[4]
Prasugrel	DM7MT6E	Major	Increased risk of bleeding by the combination of Drotrecogin alfa and Prasugrel.	Myocardial infarction [BA41-BA43]	[4]
Vorapaxar	DMA16BR	Major	Increased risk of bleeding by the combination of Drotrecogin alfa and Vorapaxar.	Myocardial infarction [BA41-BA43]	[4]
Tirofiban	DMQG17S	Major	Increased risk of bleeding by the combination of Drotrecogin alfa and Tirofiban.	Myocardial infarction [BA41-BA43]	[4]
Sibutramine	DMFJTDI	Moderate	Increased risk of bleeding by the combination of Drotrecogin alfa and Sibutramine.	Obesity [5B80-5B81]	[15]
Dexfenfluramine	DMJ7YDS	Moderate	Increased risk of bleeding by the combination of Drotrecogin alfa and Dexfenfluramine.	Obesity [5B80-5B81]	[15]
Diclofenac	DMPIHLS	Major	Increased risk of bleeding by the combination of Drotrecogin alfa and Diclofenac.	Osteoarthritis [FA00-FA05]	[4]
Nepafenac	DMYK490	Moderate	Increased risk of bleeding by the combination of Drotrecogin alfa and Nepafenac.	Osteoarthritis [FA00-FA05]	[12]
Naproxen	DMZ5RGV	Major	Increased risk of bleeding by the combination of Drotrecogin alfa and Naproxen.	Osteoarthritis [FA00-FA05]	[4]
Aspirin	DM672AH	Major	Increased risk of bleeding by the combination of Drotrecogin alfa and Aspirin.	Pain [MG30-MG3Z]	[4]
Etodolac	DM6WJO9	Major	Increased risk of bleeding by the combination of Drotrecogin alfa and Etodolac.	Pain [MG30-MG3Z]	[4]
Diflunisal	DM7EN8I	Major	Increased risk of bleeding by the combination of Drotrecogin alfa and Diflunisal.	Pain [MG30-MG3Z]	[4]
Ibuprofen	DM8VCBE	Major	Increased risk of bleeding by the combination of Drotrecogin alfa and Ibuprofen.	Pain [MG30-MG3Z]	[4]
Nabumetone	DMAT2XH	Major	Increased risk of bleeding by the combination of Drotrecogin alfa and Nabumetone.	Pain [MG30-MG3Z]	[4]
Piroxicam	DMTK234	Major	Increased risk of bleeding by the combination of Drotrecogin alfa and Piroxicam.	Pain [MG30-MG3Z]	[4]
Choline salicylate	DM8P137	Moderate	Increased risk of bleeding by the combination of Drotrecogin alfa and Choline salicylate.	Postoperative inflammation [1A00-CA43]	[16]
Ketorolac	DMI4EL5	Major	Increased risk of bleeding by the combination of Drotrecogin alfa and Ketorolac.	Postoperative inflammation [1A00-CA43]	[4]
Bromfenac	DMKB79O	Major	Increased risk of bleeding by the combination of Drotrecogin alfa and Bromfenac.	Postoperative inflammation [1A00-CA43]	[4]
Treprostinil	DMTIQF3	Major	Increased risk of bleeding by the combination of Drotrecogin alfa and Treprostinil.	Pulmonary hypertension [BB01]	[4]
Epoprostenol	DMUTYR2	Major	Increased risk of bleeding by the combination of Drotrecogin alfa and Epoprostenol.	Pulmonary hypertension [BB01]	[4]
Iloprost	DMVPZBE	Major	Increased risk of bleeding by the combination of Drotrecogin alfa and Iloprost.	Pulmonary hypertension [BB01]	[4]
Streptokinase	DM5JQ0D	Major	Increased risk of bleeding by the combination of Drotrecogin alfa and Streptokinase.	Pulmonary thromboembolism [BB00]	[4]
Salsalate	DM13P4C	Moderate	Increased risk of bleeding by the combination of Drotrecogin alfa and Salsalate.	Rheumatoid arthritis [FA20]	[17]
Meloxicam	DM2AR7L	Major	Increased risk of bleeding by the combination of Drotrecogin alfa and Meloxicam.	Rheumatoid arthritis [FA20]	[4]
Sulindac	DM2QHZU	Major	Increased risk of bleeding by the combination of Drotrecogin alfa and Sulindac.	Rheumatoid arthritis [FA20]	[4]
Oxaprozin	DM9UB0P	Major	Increased risk of bleeding by the combination of Drotrecogin alfa and Oxaprozin.	Rheumatoid arthritis [FA20]	[4]
Flurbiprofen	DMGN4BY	Major	Increased risk of bleeding by the combination of Drotrecogin alfa and Flurbiprofen.	Rheumatoid arthritis [FA20]	[4]
Fenoprofen	DML5VQ0	Major	Increased risk of bleeding by the combination of Drotrecogin alfa and Fenoprofen.	Rheumatoid arthritis [FA20]	[4]
Indomethacin	DMSC4A7	Major	Increased risk of bleeding by the combination of Drotrecogin alfa and Indomethacin.	Rheumatoid arthritis [FA20]	[4]
Tolmetin	DMWUIJE	Major	Increased risk of bleeding by the combination of Drotrecogin alfa and Tolmetin.	Rheumatoid arthritis [FA20]	[4]
Salicyclic acid	DM2F8XZ	Moderate	Increased risk of bleeding by the combination of Drotrecogin alfa and Salicyclic acid.	Seborrhoeic dermatitis [EA81]	[16]
Warfarin	DMJYCVW	Major	Increased risk of bleeding by the combination of Drotrecogin alfa and Warfarin.	Supraventricular tachyarrhythmia [BC81]	[4]
Plicamycin	DM7C8YV	Major	Increased risk of bleeding by the combination of Drotrecogin alfa and Plicamycin.	Testicular cancer [2C80]	[4]
Caplacizumab	DMPUKA7	Major	Increased risk of bleeding by the combination of Drotrecogin alfa and Caplacizumab.	Thrombocytopenia [3B64]	[4]
Anagrelide	DMSQ8MD	Major	Increased risk of bleeding by the combination of Drotrecogin alfa and Anagrelide.	Thrombocytosis [3B63]	[4]
Apixaban	DM89JLN	Major	Increased risk of bleeding by the combination of Drotrecogin alfa and Apixaban.	Thrombosis [DB61-GB90]	[4]
Cangrelor	DM8JRH0	Major	Increased risk of bleeding by the combination of Drotrecogin alfa and Cangrelor.	Thrombosis [DB61-GB90]	[4]
Brilinta	DMBR01X	Major	Increased risk of bleeding by the combination of Drotrecogin alfa and Brilinta.	Thrombosis [DB61-GB90]	[4]
Argatroban	DMFI46A	Major	Increased risk of bleeding by the combination of Drotrecogin alfa and Argatroban.	Thrombosis [DB61-GB90]	[4]
Dicumarol	DMFQCB1	Major	Increased risk of bleeding by the combination of Drotrecogin alfa and Dicumarol.	Thrombosis [DB61-GB90]	[4]
Clopidogrel	DMOL54H	Major	Increased risk of bleeding by the combination of Drotrecogin alfa and Clopidogrel.	Thrombosis [DB61-GB90]	[4]
Cabozantinib	DMIYDT4	Major	Increased risk of bleeding by the combination of Drotrecogin alfa and Cabozantinib.	Thyroid cancer [2D10]	[4]
Betrixaban	DM2C4RF	Major	Increased risk of bleeding by the combination of Drotrecogin alfa and Betrixaban.	Venous thromboembolism [BD72]	[4]
-----------


⏷ Show the Full List of 92 DDI Information of This Drug

References

1	URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6788).
2	Trend Analysis of a Database of Intravenous Pharmacokinetic Parameters in Humans for 1352 Drug Compounds
3	Protein C in critical illness. Am J Health Syst Pharm. 2009 Jun 15;66(12):1089-96.
4	Product Information. Xigris (drotrecogin alfa). Lilly, Eli and Company, Indianapolis, IN.
5	Booth SL, Golly I, Sacheck JM, Roubenoff R, Dallal GE, et al "Effect of vitamin E supplementation on vitamin K status in adults with normal coagulation status." Am J Clin Nutr 80 (2004): 143-8. [PMID: 15213041]
6	Product Information. Brukinsa (zanubrutinib). BeiGene USA, Inc, San Mateo, CA.
7	Alderman CP, Moritz CK, Ben-Tovim DI "Abnormal platelet aggregation associated with fluoxetine therapy." Ann Pharmacother 26 (1992): 1517-9. [PMID: 1482806]
8	Product Information. Fragmin (dalteparin). Pharmacia and Upjohn, Kalamazoo, MI.
9	Product Information. Panhematin (hemin). Recordati Rare Diseases Inc, Lebanon, NJ.
10	Heck AM, DeWitt BA, Lukes AL "Potential interactions between alternative therapies and warfarin." Am J Health Syst Pharm 57 (2000): 1221-7 quiz 1228-30. [PMID: 10902065]
11	Canadian Pharmacists Association.
12	Product Information. Acular (ketorolac). Allergan Inc, Irvine, CA.
13	Product Information. Aptivus (tipranavir). Boehringer-Ingelheim, Ridgefield, CT.
14	Product Information. Bexxar I 131 Therapeutic (iodine I 131 tositumomab). GlaxoSmithKline, Research Triangle Park, NC.
15	Bannister SJ, Houser VP, Hulse JD, Kisicki JC, Rasmussen JG "Evaluation of the potential for interactions of paroxetine with diazepam, cimetidine, warfarin, and digoxin." Acta Psychiatr Scand Suppl 350 (1989): 102-6. [PMID: 2530759]
16	Fausa O "Salicylate-induced hypoprothrombinemia: a report of four cases." Acta Med Scand 188 (1970): 403-8. [PMID: 5490567]
17	Richards JR, Garber D, Laurin EG, et al. Treatment of cocaine cardiovascular toxicity: a systematic review.?Clin Toxicol (Phila). 2016;54(5):345-364. [PMID: 26919414]