Details of the Drug

General Information of Drug (ID: DM5JQ0D)

Drug Name
Streptokinase
Synonyms
Awelysin; Estreptoquinasa; Kabikinase; Streptase; Streptochinasi; Streptokinasum; Streptochinasi [DCIT]; Streptococcal fibrinolysin; Estreptoquinasa [INN-Spanish]; Streptase (TN); Streptokinasum [INN-Latin]; 4-cyclohexylpyrrolidine-2-carboxylic Acid
Indication
Disease Entry ICD 11 Status REF
Pulmonary embolism BB00 Approved [1]
Acute myocardial infarction BA41 Phase 4 [2]
Severe acute respiratory syndrome (SARS) 1D65 Discontinued in Phase 3 [3]
Therapeutic Class
Thrombolytic Agents
Drug Type
Small molecular drug
Sequence
MKNYLSFGMFALLFALTFGTVNSVQAIAGPEWLLDRPSVNNSQLVVSVAGTVEGTNQDIS
LKFFEIDLTSRPAHGGKTEQGLSPKSKPFATDSGAMSHKLEKADLLKAIQEQLIANVHSN
DDYFEVIDFASDATITDRNGKVYFADKDGSVTLPTQPVQEFLLSGHVRVRPYKEKPIQNQ
AKSVDVEYTVQFTPLNPDDDFRPGLKDTKLLKTLAIGDTITSQELLAQAQSILNKNHPGY
TIYERDSSIVTHDNDIFRTILPMDQEFTYRVKNREQAYRINKKSGLNEEINNTDLISEKY
YVLKKGEKPYDPFDRSHLKLFTIKYVDVDTNELLKSEQLLTASERNLDFRDLYDPRDKAK
LLYNNLDAFGIMDYTLTGKVEDNHDDTNRIITVYMGKRPEGENASYHLAYDKDRYTEEER
EVYSYLRYTGTPIPDNPNDK
Structure
3D MOL 2D MOL
#Ro5 Violations (Lipinski): 0 Molecular Weight (mw) 197.27
Logarithm of the Partition Coefficient (xlogp) 0.3
Rotatable Bond Count (rotbonds) 2
Hydrogen Bond Donor Count (hbonddonor) 2
Hydrogen Bond Acceptor Count (hbondacc) 3
Chemical Identifiers
Formula
C11H19NO2
IUPAC Name
4-cyclohexylpyrrolidine-2-carboxylic acid
Canonical SMILES
C1CCC(CC1)C2CC(NC2)C(=O)O
InChI
InChI=1S/C11H19NO2/c13-11(14)10-6-9(7-12-10)8-4-2-1-3-5-8/h8-10,12H,1-7H2,(H,13,14)
InChIKey
XRZWVSXEDRYQGC-UHFFFAOYSA-N
Cross-matching ID
PubChem CID
9815560
CAS Number
9002-01-1
DrugBank ID
DB00086
TTD ID
D04URO
Repurposed Drugs (RPD) Click to Jump to the Detailed RPD Information of This Drug

Molecular Interaction Atlas of This Drug


Drug Therapeutic Target (DTT)
DTT Name DTT ID UniProt ID MOA REF
Plasminogen (PLG) TTP86E2 PLMN_HUMAN Activator [4]
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This Drug

Molecular Expression Atlas of This Drug

The Studied Disease Pulmonary embolism
ICD Disease Classification BB00
Molecule Name Molecule Type Gene Name p-value Fold-Change Z-score
Plasminogen (PLG) DTT PLG 8.61E-01 -0.01 -0.09
Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This Drug

Drug-Drug Interaction (DDI) Information of This Drug

Coadministration of a Drug Treating the Disease Different from Streptokinase (Comorbidity)
DDI Drug Name DDI Drug ID Severity Mechanism Comorbidity REF
Cilostazol DMZMSCT Moderate Increased risk of bleeding by the combination of Streptokinase and Cilostazol. Arterial occlusive disease [BD40] [5]
Pentosan polysulfate DM2HRKE Moderate Increased risk of bleeding by the combination of Streptokinase and Pentosan polysulfate. Chronic pain [MG30] [6]
Ketoprofen DMRKXPT Moderate Increased risk of bleeding by the combination of Streptokinase and Ketoprofen. Chronic pain [MG30] [7]
Levomilnacipran DMV26S8 Moderate Increased risk of bleeding by the combination of Streptokinase and Levomilnacipran. Chronic pain [MG30] [8]
Regorafenib DMHSY1I Major Increased risk of bleeding by the combination of Streptokinase and Regorafenib. Colorectal cancer [2B91] [9]
Intedanib DMSTA36 Moderate Increased risk of bleeding by the combination of Streptokinase and Intedanib. Colorectal cancer [2B91] [10]
Ardeparin DMYRX8B Major Increased risk of bleeding by the combination of Streptokinase and Ardeparin. Coronary thrombosis [BA43] [11]
Rivaroxaban DMQMBZ1 Major Increased risk of bleeding by the combination of Streptokinase and Rivaroxaban. Deep vein thrombosis [BD71] [12]
Sertraline DM0FB1J Moderate Increased risk of bleeding by the combination of Streptokinase and Sertraline. Depression [6A70-6A7Z] [8]
Fluoxetine DM3PD2C Moderate Increased risk of bleeding by the combination of Streptokinase and Fluoxetine. Depression [6A70-6A7Z] [8]
Vilazodone DM4LECQ Moderate Increased risk of bleeding by the combination of Streptokinase and Vilazodone. Depression [6A70-6A7Z] [8]
Paroxetine DM5PVQE Moderate Increased risk of bleeding by the combination of Streptokinase and Paroxetine. Depression [6A70-6A7Z] [8]
Vortioxetine DM6F1PU Moderate Increased risk of bleeding by the combination of Streptokinase and Vortioxetine. Depression [6A70-6A7Z] [8]
Duloxetine DM9BI7M Moderate Increased risk of bleeding by the combination of Streptokinase and Duloxetine. Depression [6A70-6A7Z] [8]
Milnacipran DMBFE74 Moderate Increased risk of bleeding by the combination of Streptokinase and Milnacipran. Depression [6A70-6A7Z] [8]
Escitalopram DMFK9HG Moderate Increased risk of bleeding by the combination of Streptokinase and Escitalopram. Depression [6A70-6A7Z] [8]
Desvenlafaxine DMHD4PE Moderate Increased risk of bleeding by the combination of Streptokinase and Desvenlafaxine. Depression [6A70-6A7Z] [8]
Clomipramine DMINRKW Moderate Increased risk of bleeding by the combination of Streptokinase and Clomipramine. Depression [6A70-6A7Z] [8]
Fluvoxamine DMQTJSX Moderate Increased risk of bleeding by the combination of Streptokinase and Fluvoxamine. Depression [6A70-6A7Z] [8]
Venlafaxine DMR6QH0 Moderate Increased risk of bleeding by the combination of Streptokinase and Venlafaxine. Depression [6A70-6A7Z] [8]
Apigenin DMI3491 Minor Increased risk of bleeding by the combination of Streptokinase and Apigenin. Discovery agent [N.A.] [13]
Citalopram derivative 1 DMITX1G Moderate Increased risk of bleeding by the combination of Streptokinase and Citalopram derivative 1. Discovery agent [N.A.] [8]
PMID28870136-Compound-49 DMTUC9E Moderate Increased risk of bleeding by the combination of Streptokinase and PMID28870136-Compound-49. Discovery agent [N.A.] [14]
Fenfluramine DM0762O Moderate Increased risk of bleeding by the combination of Streptokinase and Fenfluramine. Epilepsy/seizure [8A61-8A6Z] [8]
Suprofen DMKXJZ7 Moderate Increased risk of bleeding by the combination of Streptokinase and Suprofen. Eye anterior segment structural developmental anomaly [LA11] [7]
Mefenamic acid DMK7HFI Moderate Increased risk of bleeding by the combination of Streptokinase and Mefenamic acid. Female pelvic pain [GA34] [7]
Avapritinib DMK2GZX Major Increased risk of bleeding by the combination of Streptokinase and Avapritinib. Gastrointestinal stromal tumour [2B5B] [9]
Ramipril DM2R68E Moderate Increased risk of angioedema by the combination of Streptokinase and Ramipril. Heart failure [BD10-BD1Z] [15]
Tipranavir DM8HJX6 Major Increased risk of bleeding by the combination of Streptokinase and Tipranavir. Human immunodeficiency virus disease [1C60-1C62] [16]
Moexipril DM26E4B Moderate Increased risk of angioedema by the combination of Streptokinase and Moexipril. Hypertension [BA00-BA04] [15]
Captopril DM458UM Moderate Increased risk of angioedema by the combination of Streptokinase and Captopril. Hypertension [BA00-BA04] [15]
Trandolapril DM4L6EU Moderate Increased risk of angioedema by the combination of Streptokinase and Trandolapril. Hypertension [BA00-BA04] [15]
Enalapril DMNFUZR Moderate Increased risk of angioedema by the combination of Streptokinase and Enalapril. Hypertension [BA00-BA04] [15]
Perindopril DMOPZDT Moderate Increased risk of angioedema by the combination of Streptokinase and Perindopril. Hypertension [BA00-BA04] [15]
Quinapril DMR8H31 Moderate Increased risk of angioedema by the combination of Streptokinase and Quinapril. Hypertension [BA00-BA04] [15]
Lisinopril DMUOK4C Moderate Increased risk of angioedema by the combination of Streptokinase and Lisinopril. Hypertension [BA00-BA04] [15]
Dipyridamole DMXY30O Moderate Increased risk of bleeding by the combination of Streptokinase and Dipyridamole. Hypertension [BA00-BA04] [5]
Meclofenamic acid DM05FXR Moderate Increased risk of bleeding by the combination of Streptokinase and Meclofenamic acid. Inflammatory spondyloarthritis [FA92] [7]
Ticlopidine DMO946V Moderate Increased risk of bleeding by the combination of Streptokinase and Ticlopidine. Ischaemic/haemorrhagic stroke [8B20] [5]
Acalabrutinib DM7GCVW Major Increased risk of bleeding by the combination of Streptokinase and Acalabrutinib. Mature B-cell lymphoma [2A85] [17]
Ibrutinib DMHZCPO Major Increased risk of bleeding by the combination of Streptokinase and Ibrutinib. Mature B-cell lymphoma [2A85] [18]
Ponatinib DMYGJQO Major Increased risk of bleeding by the combination of Streptokinase and Ponatinib. Mature B-cell lymphoma [2A85] [19]
Panobinostat DM58WKG Major Increased risk of bleeding by the combination of Streptokinase and Panobinostat. Multiple myeloma [2A83] [15]
Dasatinib DMJV2EK Major Increased risk of bleeding by the combination of Streptokinase and Dasatinib. Myeloproliferative neoplasm [2A20] [20]
Omacetaxine mepesuccinate DMPU2WX Major Increased risk of bleeding by the combination of Streptokinase and Omacetaxine mepesuccinate. Myeloproliferative neoplasm [2A20] [6]
Prasugrel DM7MT6E Major Increased risk of bleeding by the combination of Streptokinase and Prasugrel. Myocardial infarction [BA41-BA43] [9]
Vorapaxar DMA16BR Major Increased risk of bleeding by the combination of Streptokinase and Vorapaxar. Myocardial infarction [BA41-BA43] [21]
Sibutramine DMFJTDI Moderate Increased risk of bleeding by the combination of Streptokinase and Sibutramine. Obesity [5B80-5B81] [22]
Diclofenac DMPIHLS Moderate Increased risk of bleeding by the combination of Streptokinase and Diclofenac. Osteoarthritis [FA00-FA05] [7]
Nepafenac DMYK490 Moderate Increased risk of bleeding by the combination of Streptokinase and Nepafenac. Osteoarthritis [FA00-FA05] [7]
Naproxen DMZ5RGV Moderate Increased risk of bleeding by the combination of Streptokinase and Naproxen. Osteoarthritis [FA00-FA05] [7]
MK-4827 DMLYGH4 Moderate Increased risk of bleeding by the combination of Streptokinase and MK-4827. Ovarian cancer [2C73] [9]
Aspirin DM672AH Moderate Increased risk of bleeding by the combination of Streptokinase and Aspirin. Pain [MG30-MG3Z] [5]
Etodolac DM6WJO9 Moderate Increased risk of bleeding by the combination of Streptokinase and Etodolac. Pain [MG30-MG3Z] [7]
Diflunisal DM7EN8I Moderate Increased risk of bleeding by the combination of Streptokinase and Diflunisal. Pain [MG30-MG3Z] [5]
Ibuprofen DM8VCBE Moderate Increased risk of bleeding by the combination of Streptokinase and Ibuprofen. Pain [MG30-MG3Z] [7]
Nabumetone DMAT2XH Moderate Increased risk of bleeding by the combination of Streptokinase and Nabumetone. Pain [MG30-MG3Z] [7]
Piroxicam DMTK234 Moderate Increased risk of bleeding by the combination of Streptokinase and Piroxicam. Pain [MG30-MG3Z] [7]
Choline salicylate DM8P137 Moderate Increased risk of bleeding by the combination of Streptokinase and Choline salicylate. Postoperative inflammation [1A00-CA43] [5]
Ketorolac DMI4EL5 Moderate Increased risk of bleeding by the combination of Streptokinase and Ketorolac. Postoperative inflammation [1A00-CA43] [7]
Bromfenac DMKB79O Moderate Increased risk of bleeding by the combination of Streptokinase and Bromfenac. Postoperative inflammation [1A00-CA43] [7]
Treprostinil DMTIQF3 Moderate Increased risk of bleeding by the combination of Streptokinase and Treprostinil. Pulmonary hypertension [BB01] [5]
Epoprostenol DMUTYR2 Moderate Increased risk of bleeding by the combination of Streptokinase and Epoprostenol. Pulmonary hypertension [BB01] [5]
Iloprost DMVPZBE Moderate Increased risk of bleeding by the combination of Streptokinase and Iloprost. Pulmonary hypertension [BB01] [5]
Salsalate DM13P4C Moderate Increased risk of bleeding by the combination of Streptokinase and Salsalate. Rheumatoid arthritis [FA20] [5]
Meloxicam DM2AR7L Moderate Increased risk of bleeding by the combination of Streptokinase and Meloxicam. Rheumatoid arthritis [FA20] [7]
Sulindac DM2QHZU Moderate Increased risk of bleeding by the combination of Streptokinase and Sulindac. Rheumatoid arthritis [FA20] [7]
Oxaprozin DM9UB0P Moderate Increased risk of bleeding by the combination of Streptokinase and Oxaprozin. Rheumatoid arthritis [FA20] [7]
Flurbiprofen DMGN4BY Moderate Increased risk of bleeding by the combination of Streptokinase and Flurbiprofen. Rheumatoid arthritis [FA20] [7]
Fenoprofen DML5VQ0 Moderate Increased risk of bleeding by the combination of Streptokinase and Fenoprofen. Rheumatoid arthritis [FA20] [7]
Indomethacin DMSC4A7 Moderate Increased risk of bleeding by the combination of Streptokinase and Indomethacin. Rheumatoid arthritis [FA20] [7]
Tolmetin DMWUIJE Moderate Increased risk of bleeding by the combination of Streptokinase and Tolmetin. Rheumatoid arthritis [FA20] [7]
Curcumin DMQPH29 Minor Increased risk of bleeding by the combination of Streptokinase and Curcumin. Solid tumour/cancer [2A00-2F9Z] [23]
Caplacizumab DMPUKA7 Major Increased risk of bleeding by the combination of Streptokinase and Caplacizumab. Thrombocytopenia [3B64] [15]
Apixaban DM89JLN Major Increased risk of bleeding by the combination of Streptokinase and Apixaban. Thrombosis [DB61-GB90] [9]
Cangrelor DM8JRH0 Major Increased risk of bleeding by the combination of Streptokinase and Cangrelor. Thrombosis [DB61-GB90] [24]
Brilinta DMBR01X Moderate Increased risk of bleeding by the combination of Streptokinase and Brilinta. Thrombosis [DB61-GB90] [9]
Argatroban DMFI46A Major Increased risk of bleeding by the combination of Streptokinase and Argatroban. Thrombosis [DB61-GB90] [25]
Clopidogrel DMOL54H Moderate Increased risk of bleeding by the combination of Streptokinase and Clopidogrel. Thrombosis [DB61-GB90] [5]
Cabozantinib DMIYDT4 Major Increased risk of bleeding by the combination of Streptokinase and Cabozantinib. Thyroid cancer [2D10] [26]
Betrixaban DM2C4RF Major Increased risk of bleeding by the combination of Streptokinase and Betrixaban. Venous thromboembolism [BD72] [24]
⏷ Show the Full List of 81 DDI Information of This Drug

References

1 Emerging drugs for chemotherapy-induced mucositis. Expert Opin Emerg Drugs. 2008 Sep;13(3):511-22.
2 ClinicalTrials.gov (NCT00302419) Effect of Complementary Intracoronary Streptokinase Administration Immediately After Primary Percutaneous Coronary Intervention on Microvascular Perfusion and Late Term Infarct Size in Patients With Acute Myocardial Infarction. U.S. National Institutes of Health.
3 ClinicalTrials.gov (NCT03465085) Streptokinase Versus Unfractionated Heparin Nebulization in Severe ARDS. U.S. National Institutes of Health.
4 Acute anuric renal failure with streptokinase therapy in a patient with acute venous thromboembolic disease and the review of renal side effects of streptokinase. Tuberk Toraks. 2008;56(4):456-61.
5 Harder S, Klinkhardt U "Thrombolytics: drug interactions of clinical significance." Drug Saf 23 (2000): 391-9. [PMID: 11085346]
6 Product Information. Brukinsa (zanubrutinib). BeiGene USA, Inc, San Mateo, CA.
7 Product Information. Acular (ketorolac). Allergan Inc, Irvine, CA.
8 Alderman CP, Moritz CK, Ben-Tovim DI "Abnormal platelet aggregation associated with fluoxetine therapy." Ann Pharmacother 26 (1992): 1517-9. [PMID: 1482806]
9 Cerner Multum, Inc. "UK Summary of Product Characteristics.".
10 Product Information. Ofev (nintedanib). Boehringer Ingelheim, Ridgefield, CT.
11 Price AJ, Frcpath DO "Is there a clinical interaction between low molecular weight heparin and non-steroidal analgesics after total hip replacement?" Ann R Coll Surg Engl 77 (1995): 395. [PMID: 7486773]
12 Product Information. Xarelto (rivaroxaban). Bayer Inc, Toronto, IA.
13 Heck AM, DeWitt BA, Lukes AL "Potential interactions between alternative therapies and warfarin." Am J Health Syst Pharm 57 (2000): 1221-7 quiz 1228-30. [PMID: 10902065]
14 Canadian Pharmacists Association.
15 Cerner Multum, Inc. "Australian Product Information.".
16 Product Information. Aptivus (tipranavir). Boehringer-Ingelheim, Ridgefield, CT.
17 Product Information. Calquence (acalabrutinib). Astra-Zeneca Pharmaceuticals, Wilmington, DE.
18 Agencia Espaola de Medicamentos y Productos Sanitarios Healthcare "Centro de informacion online de medicamentos de la AEMPS - CIMA.".
19 Product Information. Iclusig (ponatinib). Ariad Pharmaceuticals Inc, Cambridge, MA.
20 Product Information. Sprycel (dasatinib). Bristol-Myers Squibb, Princeton, NJ.
21 Product Information. Zontivity (vorapaxar). Merck & Company Inc, Whitehouse Station, NJ.
22 Bannister SJ, Houser VP, Hulse JD, Kisicki JC, Rasmussen JG "Evaluation of the potential for interactions of paroxetine with diazepam, cimetidine, warfarin, and digoxin." Acta Psychiatr Scand Suppl 350 (1989): 102-6. [PMID: 2530759]
23 Abebe W "Herbal medication: potential for adverse interactions with analgesic drugs." J Clin Pharm Ther 27 (2002): 391-401. [PMID: 12472978]
24 Bodiford AB, Kessler FO, Fermo JD, Ragucci KR "Elevated international normalized ratio with the consumption of grapefruit and use of warfarin." SAGE Open Med Case Rep 0 (2013): 1-3. [PMID: 27489634]
25 Product Information. Acova (argatroban) SmithKline Beecham, Philadelphia, PA.
26 Product Information. Cometriq (cabozantinib). Exelixis Inc, S San Francisco, CA.