Details of the Drug

General Information of Drug (ID: DMMYZ3D)

Drug Name

Tositumomab

Synonyms

Bexxar (TN)

Indication

Disease Entry	ICD 11	Status	REF
Non-hodgkin lymphoma	2B33.5	Approved	[1], [2]

Therapeutic Class

Anticancer Agents

Drug Type

Antibody

Sequence

>heavy chain 1
QAYLQQSGAELVRPGASVKMSCKASGYTFTSYNMHWVKQTPRQGLEWIGAIYPGNGDTSY
NQKFKGKATLTVDKSSSTAYMQLSSLTSEDSAVYFCARVVYYSNSYWYFDVWGTGTTVTV
SGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLY
SLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKAEPKSCDKTHTCPPCPAPELLGGPSV
FLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTY
RVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTK
NQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQG
NVFSCSVMHEALHNHYTQKSLSLSPGK
>light chain 1
1QIVLSQSPAILSASPGEKVTMTCRASSSVSYMHWYQQKPGSSPKPWIYAPSNLASGVPA
RFSGSGSGTSYSLTISRVEAEDAATYYCQQWSFNPPTFGAGTKLELKRTVAAPSVFIFPP
SDEQLKSGTASVVCLLNNFYP
>heavy chain 2
2QAYLQQSGAELVRPGASVKMSCKASGYTFTSYNMHWVKQTPRQGLEWIGAIYPGNGDTS
YNQKFKGKATLTVDKSSSTAYMQLSSLTSEDSAVYFCARVVYYSNSYWYFDVWGTGTTVT
VSGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGL
YSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKAEPKSCDKTHTCPPCPAPELLGGPS
VFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNST
YRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELT
KNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQ
GNVFSCSVMHEALHNHYTQKSLSLSPGK
>light chain 2
2QIVLSQSPAILSASPGEKVTMTCRASSSVSYMHWYQQKPGSSPKPWIYAPSNLASGVPA
RFSGSGSGTSYSLTISRVEAEDAATYYCQQWSFNPPTFGAGTKLELKRTVAAPSVFIFPP
SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT
LSKADYEKHKVYACEVTHQGLSSPVTKSFNR

ADMET Property

Half-life: The concentration or amount of drug in body reduced by one-half in 0.8 hours [3]
Metabolism: The drug is metabolized via opsonization via the reticuloendothelial system [4]

Cross-matching ID

DrugBank ID: DB00081
TTD ID: D0I2AV

Molecular Interaction Atlas of This Drug

Drug Therapeutic Target (DTT)

DTT Name	DTT ID	UniProt ID	MOA	REF
Leukocyte surface antigen Leu-16 (CD20)	TTUE541	CD20_HUMAN	Not Available	[5]

------------------------------------------------------------------------------------

Molecular Interaction Atlas (MIA)

MIA Detail

Jump to Detail Molecular Interaction Atlas of This Drug

Drug-Drug Interaction (DDI) Information of This Drug

Coadministration of a Drug Treating the Disease Different from Tositumomab (Comorbidity)

DDI Drug Name	DDI Drug ID	Severity	Mechanism	Comorbidity	REF
Cilostazol	DMZMSCT	Major	Increased risk of bleeding by the combination of Tositumomab and Cilostazol.	Arterial occlusive disease [BD40]	[15]
Roflumilast	DMPGHY8	Moderate	Additive immunosuppressive effects by the combination of Tositumomab and Roflumilast.	Asthma [CA23]	[16]
Pentosan polysulfate	DM2HRKE	Moderate	Increased risk of bleeding by the combination of Tositumomab and Pentosan polysulfate.	Chronic pain [MG30]	[17]
Ketoprofen	DMRKXPT	Major	Increased risk of bleeding by the combination of Tositumomab and Ketoprofen.	Chronic pain [MG30]	[15]
Levomilnacipran	DMV26S8	Moderate	Increased risk of bleeding by the combination of Tositumomab and Levomilnacipran.	Chronic pain [MG30]	[18]
Regorafenib	DMHSY1I	Major	Increased risk of bleeding by the combination of Tositumomab and Regorafenib.	Colorectal cancer [2B91]	[16]
Ardeparin	DMYRX8B	Major	Increased risk of bleeding by the combination of Tositumomab and Ardeparin.	Coronary thrombosis [BA43]	[15]
Rivaroxaban	DMQMBZ1	Major	Increased risk of bleeding by the combination of Tositumomab and Rivaroxaban.	Deep vein thrombosis [BD71]	[15]
Sertraline	DM0FB1J	Moderate	Increased risk of bleeding by the combination of Tositumomab and Sertraline.	Depression [6A70-6A7Z]	[18]
Fluoxetine	DM3PD2C	Moderate	Increased risk of bleeding by the combination of Tositumomab and Fluoxetine.	Depression [6A70-6A7Z]	[18]
Vilazodone	DM4LECQ	Moderate	Increased risk of bleeding by the combination of Tositumomab and Vilazodone.	Depression [6A70-6A7Z]	[18]
Paroxetine	DM5PVQE	Moderate	Increased risk of bleeding by the combination of Tositumomab and Paroxetine.	Depression [6A70-6A7Z]	[18]
Vortioxetine	DM6F1PU	Moderate	Increased risk of bleeding by the combination of Tositumomab and Vortioxetine.	Depression [6A70-6A7Z]	[18]
Duloxetine	DM9BI7M	Moderate	Increased risk of bleeding by the combination of Tositumomab and Duloxetine.	Depression [6A70-6A7Z]	[18]
Milnacipran	DMBFE74	Moderate	Increased risk of bleeding by the combination of Tositumomab and Milnacipran.	Depression [6A70-6A7Z]	[18]
Escitalopram	DMFK9HG	Moderate	Increased risk of bleeding by the combination of Tositumomab and Escitalopram.	Depression [6A70-6A7Z]	[18]
Desvenlafaxine	DMHD4PE	Moderate	Increased risk of bleeding by the combination of Tositumomab and Desvenlafaxine.	Depression [6A70-6A7Z]	[18]
Clomipramine	DMINRKW	Moderate	Increased risk of bleeding by the combination of Tositumomab and Clomipramine.	Depression [6A70-6A7Z]	[18]
Fluvoxamine	DMQTJSX	Moderate	Increased risk of bleeding by the combination of Tositumomab and Fluvoxamine.	Depression [6A70-6A7Z]	[18]
Venlafaxine	DMR6QH0	Moderate	Increased risk of bleeding by the combination of Tositumomab and Venlafaxine.	Depression [6A70-6A7Z]	[18]
Apigenin	DMI3491	Minor	Increased risk of bleeding by the combination of Tositumomab and Apigenin.	Discovery agent [N.A.]	[19]
Citalopram derivative 1	DMITX1G	Moderate	Increased risk of bleeding by the combination of Tositumomab and Citalopram derivative 1.	Discovery agent [N.A.]	[18]
Fenfluramine	DM0762O	Moderate	Increased risk of bleeding by the combination of Tositumomab and Fenfluramine.	Epilepsy/seizure [8A61-8A6Z]	[18]
Suprofen	DMKXJZ7	Moderate	Increased risk of bleeding by the combination of Tositumomab and Suprofen.	Eye anterior segment structural developmental anomaly [LA11]	[20]
Mefenamic acid	DMK7HFI	Major	Increased risk of bleeding by the combination of Tositumomab and Mefenamic acid.	Female pelvic pain [GA34]	[15]
Tazemetostat	DMWP1BH	Major	Increased risk of bleeding by the combination of Tositumomab and Tazemetostat.	Follicular lymphoma [2A80]	[15]
Avapritinib	DMK2GZX	Major	Increased risk of bleeding by the combination of Tositumomab and Avapritinib.	Gastrointestinal stromal tumour [2B5B]	[16]
Tipranavir	DM8HJX6	Major	Increased risk of bleeding by the combination of Tositumomab and Tipranavir.	Human immunodeficiency virus disease [1C60-1C62]	[21]
Teriflunomide	DMQ2FKJ	Major	Additive immunosuppressive effects by the combination of Tositumomab and Teriflunomide.	Hyper-lipoproteinaemia [5C80]	[22]
Dipyridamole	DMXY30O	Major	Increased risk of bleeding by the combination of Tositumomab and Dipyridamole.	Hypertension [BA00-BA04]	[15]
Meclofenamic acid	DM05FXR	Major	Increased risk of bleeding by the combination of Tositumomab and Meclofenamic acid.	Inflammatory spondyloarthritis [FA92]	[15]
Ticlopidine	DMO946V	Major	Increased risk of bleeding by the combination of Tositumomab and Ticlopidine.	Ischaemic/haemorrhagic stroke [8B20]	[15]
Denosumab	DMNI0KO	Moderate	Additive immunosuppressive effects by the combination of Tositumomab and Denosumab.	Low bone mass disorder [FB83]	[23]
Cladribine	DM3JDRP	Major	Additive immunosuppressive effects by the combination of Tositumomab and Cladribine.	Mature B-cell leukaemia [2A82]	[16]
Alemtuzumab	DMZL3IV	Moderate	Additive immunosuppressive effects by the combination of Tositumomab and Alemtuzumab.	Mature B-cell leukaemia [2A82]	[24]
Acalabrutinib	DM7GCVW	Major	Increased risk of bleeding by the combination of Tositumomab and Acalabrutinib.	Mature B-cell lymphoma [2A85]	[25]
Ibrutinib	DMHZCPO	Major	Increased risk of bleeding by the combination of Tositumomab and Ibrutinib.	Mature B-cell lymphoma [2A85]	[26]
Ponatinib	DMYGJQO	Major	Increased risk of bleeding by the combination of Tositumomab and Ponatinib.	Mature B-cell lymphoma [2A85]	[27]
Arry-162	DM1P6FR	Major	Increased risk of bleeding by the combination of Tositumomab and Arry-162.	Melanoma [2C30]	[15]
LGX818	DMNQXV8	Major	Increased risk of bleeding by the combination of Tositumomab and LGX818.	Melanoma [2C30]	[15]
Tecfidera	DM2OVDT	Moderate	Additive immunosuppressive effects by the combination of Tositumomab and Tecfidera.	Multiple sclerosis [8A40]	[28]
Siponimod	DM2R86O	Major	Additive immunosuppressive effects by the combination of Tositumomab and Siponimod.	Multiple sclerosis [8A40]	[29]
Fingolimod	DM5JVAN	Major	Additive immunosuppressive effects by the combination of Tositumomab and Fingolimod.	Multiple sclerosis [8A40]	[30]
Ocrelizumab	DMEZ2KH	Moderate	Additive immunosuppressive effects by the combination of Tositumomab and Ocrelizumab.	Multiple sclerosis [8A40]	[31]
Ozanimod	DMT6AM2	Major	Additive immunosuppressive effects by the combination of Tositumomab and Ozanimod.	Multiple sclerosis [8A40]	[16]
Fedratinib	DM4ZBK6	Major	Increased risk of bleeding by the combination of Tositumomab and Fedratinib.	Myeloproliferative neoplasm [2A20]	[15]
Ruxolitinib	DM7Q98D	Major	Increased risk of bleeding by the combination of Tositumomab and Ruxolitinib.	Myeloproliferative neoplasm [2A20]	[15]
Dasatinib	DMJV2EK	Major	Increased risk of bleeding by the combination of Tositumomab and Dasatinib.	Myeloproliferative neoplasm [2A20]	[15]
Omacetaxine mepesuccinate	DMPU2WX	Major	Increased risk of bleeding by the combination of Tositumomab and Omacetaxine mepesuccinate.	Myeloproliferative neoplasm [2A20]	[17]
Prasugrel	DM7MT6E	Major	Increased risk of bleeding by the combination of Tositumomab and Prasugrel.	Myocardial infarction [BA41-BA43]	[15]
Vorapaxar	DMA16BR	Major	Increased risk of bleeding by the combination of Tositumomab and Vorapaxar.	Myocardial infarction [BA41-BA43]	[15]
Tirofiban	DMQG17S	Major	Increased risk of bleeding by the combination of Tositumomab and Tirofiban.	Myocardial infarction [BA41-BA43]	[15]
Sibutramine	DMFJTDI	Moderate	Increased risk of bleeding by the combination of Tositumomab and Sibutramine.	Obesity [5B80-5B81]	[32]
Diclofenac	DMPIHLS	Major	Increased risk of bleeding by the combination of Tositumomab and Diclofenac.	Osteoarthritis [FA00-FA05]	[15]
Nepafenac	DMYK490	Moderate	Increased risk of bleeding by the combination of Tositumomab and Nepafenac.	Osteoarthritis [FA00-FA05]	[20]
Naproxen	DMZ5RGV	Major	Increased risk of bleeding by the combination of Tositumomab and Naproxen.	Osteoarthritis [FA00-FA05]	[15]
Aspirin	DM672AH	Major	Increased risk of bleeding by the combination of Tositumomab and Aspirin.	Pain [MG30-MG3Z]	[15]
Etodolac	DM6WJO9	Major	Increased risk of bleeding by the combination of Tositumomab and Etodolac.	Pain [MG30-MG3Z]	[15]
Diflunisal	DM7EN8I	Major	Increased risk of bleeding by the combination of Tositumomab and Diflunisal.	Pain [MG30-MG3Z]	[15]
Ibuprofen	DM8VCBE	Major	Increased risk of bleeding by the combination of Tositumomab and Ibuprofen.	Pain [MG30-MG3Z]	[15]
Nabumetone	DMAT2XH	Major	Increased risk of bleeding by the combination of Tositumomab and Nabumetone.	Pain [MG30-MG3Z]	[15]
Piroxicam	DMTK234	Major	Increased risk of bleeding by the combination of Tositumomab and Piroxicam.	Pain [MG30-MG3Z]	[15]
Ketorolac	DMI4EL5	Major	Increased risk of bleeding by the combination of Tositumomab and Ketorolac.	Postoperative inflammation [1A00-CA43]	[15]
Bromfenac	DMKB79O	Moderate	Increased risk of bleeding by the combination of Tositumomab and Bromfenac.	Postoperative inflammation [1A00-CA43]	[20]
Treprostinil	DMTIQF3	Major	Increased risk of bleeding by the combination of Tositumomab and Treprostinil.	Pulmonary hypertension [BB01]	[15]
Epoprostenol	DMUTYR2	Major	Increased risk of bleeding by the combination of Tositumomab and Epoprostenol.	Pulmonary hypertension [BB01]	[15]
Iloprost	DMVPZBE	Major	Increased risk of bleeding by the combination of Tositumomab and Iloprost.	Pulmonary hypertension [BB01]	[15]
Meloxicam	DM2AR7L	Major	Increased risk of bleeding by the combination of Tositumomab and Meloxicam.	Rheumatoid arthritis [FA20]	[15]
Sulindac	DM2QHZU	Major	Increased risk of bleeding by the combination of Tositumomab and Sulindac.	Rheumatoid arthritis [FA20]	[15]
Canakinumab	DM8HLO5	Moderate	Additive immunosuppressive effects by the combination of Tositumomab and Canakinumab.	Rheumatoid arthritis [FA20]	[33]
Oxaprozin	DM9UB0P	Major	Increased risk of bleeding by the combination of Tositumomab and Oxaprozin.	Rheumatoid arthritis [FA20]	[15]
Rilonacept	DMGLUQS	Moderate	Additive immunosuppressive effects by the combination of Tositumomab and Rilonacept.	Rheumatoid arthritis [FA20]	[33]
Flurbiprofen	DMGN4BY	Major	Increased risk of bleeding by the combination of Tositumomab and Flurbiprofen.	Rheumatoid arthritis [FA20]	[15]
Golimumab	DMHZV7X	Major	Additive immunosuppressive effects by the combination of Tositumomab and Golimumab.	Rheumatoid arthritis [FA20]	[34]
Fenoprofen	DML5VQ0	Major	Increased risk of bleeding by the combination of Tositumomab and Fenoprofen.	Rheumatoid arthritis [FA20]	[15]
Leflunomide	DMR8ONJ	Major	Additive immunosuppressive effects by the combination of Tositumomab and Leflunomide.	Rheumatoid arthritis [FA20]	[22]
Indomethacin	DMSC4A7	Major	Increased risk of bleeding by the combination of Tositumomab and Indomethacin.	Rheumatoid arthritis [FA20]	[15]
Tolmetin	DMWUIJE	Major	Increased risk of bleeding by the combination of Tositumomab and Tolmetin.	Rheumatoid arthritis [FA20]	[15]
Anthrax vaccine	DM9GSWY	Moderate	Antagonize the effect of Tositumomab when combined with Anthrax vaccine.	Sepsis [1G40-1G41]	[35]
Warfarin	DMJYCVW	Major	Increased risk of bleeding by the combination of Tositumomab and Warfarin.	Supraventricular tachyarrhythmia [BC81]	[15]
Caplacizumab	DMPUKA7	Major	Increased risk of bleeding by the combination of Tositumomab and Caplacizumab.	Thrombocytopenia [3B64]	[15]
Anagrelide	DMSQ8MD	Major	Increased risk of bleeding by the combination of Tositumomab and Anagrelide.	Thrombocytosis [3B63]	[15]
Apixaban	DM89JLN	Major	Increased risk of bleeding by the combination of Tositumomab and Apixaban.	Thrombosis [DB61-GB90]	[15]
Cangrelor	DM8JRH0	Major	Increased risk of bleeding by the combination of Tositumomab and Cangrelor.	Thrombosis [DB61-GB90]	[15]
Brilinta	DMBR01X	Moderate	Increased risk of bleeding by the combination of Tositumomab and Brilinta.	Thrombosis [DB61-GB90]	[16]
Argatroban	DMFI46A	Major	Increased risk of bleeding by the combination of Tositumomab and Argatroban.	Thrombosis [DB61-GB90]	[15]
Clopidogrel	DMOL54H	Major	Increased risk of bleeding by the combination of Tositumomab and Clopidogrel.	Thrombosis [DB61-GB90]	[15]
Cabozantinib	DMIYDT4	Major	Increased risk of bleeding by the combination of Tositumomab and Cabozantinib.	Thyroid cancer [2D10]	[36]
Azathioprine	DMMZSXQ	Moderate	Additive immunosuppressive effects by the combination of Tositumomab and Azathioprine.	Transplant rejection [NE84]	[29]
Betrixaban	DM2C4RF	Major	Increased risk of bleeding by the combination of Tositumomab and Betrixaban.	Venous thromboembolism [BD72]	[15]
Ganciclovir	DM1MBYQ	Moderate	Additive myelosuppressive effects by the combination of Tositumomab and Ganciclovir.	Virus infection [1A24-1D9Z]	[29]
Valganciclovir	DMS2IUH	Moderate	Additive myelosuppressive effects by the combination of Tositumomab and Valganciclovir.	Virus infection [1A24-1D9Z]	[29]
-----------


⏷ Show the Full List of 92 DDI Information of This Drug

References

1	URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6781).
2	Natural products as sources of new drugs over the last 25 years. J Nat Prod. 2007 Mar;70(3):461-77.
3	Trend Analysis of a Database of Intravenous Pharmacokinetic Parameters in Humans for 1352 Drug Compounds
4	FDA approval: ado-trastuzumab emtansine for the treatment of patients with HER2-positive metastatic breast cancer. Clin Cancer Res. 2014 Sep 1;20(17):4436-41.
5	Structure of the Fab fragment of therapeutic antibody Ofatumumab provides insights into the recognition mechanism with CD20. Mol Immunol. 2009 Jul;46(11-12):2419-23.
6	Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA)
7	[Contribution of radioimmunotherapy to the treatment of lymphoma]. Ann Pharm Fr. 2008 Nov-Dec;66(5-6):300-8.
8	URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 2628).
9	Hughes B: 2009 FDA drug approvals. Nat Rev Drug Discov. 2010 Feb;9(2):89-92.
10	Clinical pipeline report, company report or official report of Genentech (2009).
11	Emerging drugs for rheumatoid arthritis. Expert Opin Emerg Drugs. 2008 Mar;13(1):175-96.
12	Clinical pipeline report, company report or official report of Roche (2009).
13	Mitigating the risk of cytokine release syndrome in a Phase I trial of CD20/CD3 bispecific antibody mosunetuzumab in NHL: impact of translational system modeling. NPJ Syst Biol Appl. 2020 Aug 28;6(1):28.
14	Clinical pipeline report, company report or official report of Genmab.
15	Product Information. Bexxar I 131 Therapeutic (iodine I 131 tositumomab). GlaxoSmithKline, Research Triangle Park, NC.
16	Cerner Multum, Inc. "UK Summary of Product Characteristics.".
17	Product Information. Brukinsa (zanubrutinib). BeiGene USA, Inc, San Mateo, CA.
18	Alderman CP, Moritz CK, Ben-Tovim DI "Abnormal platelet aggregation associated with fluoxetine therapy." Ann Pharmacother 26 (1992): 1517-9. [PMID: 1482806]
19	Heck AM, DeWitt BA, Lukes AL "Potential interactions between alternative therapies and warfarin." Am J Health Syst Pharm 57 (2000): 1221-7 quiz 1228-30. [PMID: 10902065]
20	Product Information. Acular (ketorolac). Allergan Inc, Irvine, CA.
21	Product Information. Aptivus (tipranavir). Boehringer-Ingelheim, Ridgefield, CT.
22	Product Information. Arava (leflunomide). Hoechst Marion-Roussel Inc, Kansas City, MO.
23	Product Information. Prolia (denosumab). Amgen USA, Thousand Oaks, CA.
24	Product Information. Campath (alemtuzumab) Berlex, Richmond, CA.
25	Product Information. Calquence (acalabrutinib). Astra-Zeneca Pharmaceuticals, Wilmington, DE.
26	Agencia Espaola de Medicamentos y Productos Sanitarios Healthcare "Centro de informacion online de medicamentos de la AEMPS - CIMA.".
27	Product Information. Iclusig (ponatinib). Ariad Pharmaceuticals Inc, Cambridge, MA.
28	Product Information. Vumerity (diroximel fumarate). Alkermes, Inc, Cambridge, MA.
29	Cerner Multum, Inc. "Australian Product Information.".
30	Product Information. Gilenya (fingolimod). Novartis Pharmaceuticals, East Hanover, NJ.
31	Product Information. Ocrevus (ocrelizumab). Genentech, South San Francisco, CA.
32	Bannister SJ, Houser VP, Hulse JD, Kisicki JC, Rasmussen JG "Evaluation of the potential for interactions of paroxetine with diazepam, cimetidine, warfarin, and digoxin." Acta Psychiatr Scand Suppl 350 (1989): 102-6. [PMID: 2530759]
33	Product Information. Arcalyst (rilonacept). Regeneron Pharmaceuticals Inc, Tarrytown, NY.
34	Product Information. Cimzia (certolizumab). UCB Pharma Inc, Smyrna, GA.
35	CDC. Centers for Disease Control and Prevention/ "Recommendations of the advisory committtee on immunization practices (ACIP): use of vaccines and immune globulins in persons with altered immunocompetence." MMWR Morb Mortal Wkly Rep 42(RR-04) (1993): 1-18. [PMID: 20300058]
36	Product Information. Cometriq (cabozantinib). Exelixis Inc, S San Francisco, CA.