Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT010GIS)

DOT Name RNA-binding protein PNO1 (PNO1)
Synonyms Partner of NOB1
Gene Name PNO1
Related Disease
Melanoma ( )
Acute myelogenous leukaemia ( )
Adult glioblastoma ( )
Advanced cancer ( )
Alzheimer disease ( )
Amyotrophic lateral sclerosis ( )
Arteriosclerosis ( )
Atherosclerosis ( )
Breast cancer ( )
Breast carcinoma ( )
Carcinoma ( )
Carcinoma of liver and intrahepatic biliary tract ( )
Cervical cancer ( )
Cervical carcinoma ( )
Clear cell renal carcinoma ( )
Colon cancer ( )
Colon carcinoma ( )
Congestive heart failure ( )
Diabetic kidney disease ( )
Endometriosis ( )
Epithelial ovarian cancer ( )
Esophageal cancer ( )
Frontotemporal dementia ( )
Glioblastoma multiforme ( )
Glioma ( )
Head-neck squamous cell carcinoma ( )
Hepatocellular carcinoma ( )
Liver cancer ( )
Liver cirrhosis ( )
Lung cancer ( )
Lung carcinoma ( )
Lung neoplasm ( )
Neoplasm ( )
Nervous system inflammation ( )
Non-alcoholic fatty liver disease ( )
Non-small-cell lung cancer ( )
Ovarian cancer ( )
Ovarian neoplasm ( )
Prostate cancer ( )
Prostate carcinoma ( )
Renal cell carcinoma ( )
Squamous cell carcinoma ( )
Stomach cancer ( )
Bladder cancer ( )
Teratoma ( )
Urinary bladder cancer ( )
Colorectal carcinoma ( )
Fragile X syndrome ( )
Pancreatic cancer ( )
Parkinson disease ( )
UniProt ID
PNO1_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
6G18; 6G4S; 6G4W; 6G51; 6G53; 6G5I; 6ZUO; 6ZXD; 6ZXE; 7MQ8; 7MQ9; 7MQA; 7WTS; 7WTT; 7WTU; 7WTV; 7WTW; 7WTX; 7WTZ; 7WU0
Sequence
MESEMETQSARAEEGFTQVTRKGGRRAKKRQAEQLSAAGEGGDAGRMDTEEARPAKRPVF
PPLCGDGLLSGKEETRKIPVPANRYTPLKENWMKIFTPIVEHLGLQIRFNLKSRNVEIRT
CKETKDVSALTKAADFVKAFILGFQVEDALALIRLDDLFLESFEITDVKPLKGDHLSRAI
GRIAGKGGKTKFTIENVTRTRIVLADVKVHILGSFQNIKMARTAICNLILGNPPSKVYGN
IRAVASRSADRF
Function
Part of the small subunit (SSU) processome, first precursor of the small eukaryotic ribosomal subunit. During the assembly of the SSU processome in the nucleolus, many ribosome biogenesis factors, an RNA chaperone and ribosomal proteins associate with the nascent pre-rRNA and work in concert to generate RNA folding, modifications, rearrangements and cleavage as well as targeted degradation of pre-ribosomal RNA by the RNA exosome. Positively regulates dimethylation of two adjacent adenosines in the loop of a conserved hairpin near the 3'-end of 18S rRNA.
Tissue Specificity
Expressed in liver, lung, spleen and kidney. Weakly expressed in thymus, testis and ovary. Weakly or not expressed in heart, brain, skeletal muscle, placenta, pancreas, prostate, small intestine, colon and peripheral blood leukocytes.
Reactome Pathway
Major pathway of rRNA processing in the nucleolus and cytosol (R-HSA-6791226 )
rRNA modification in the nucleus and cytosol (R-HSA-6790901 )

Molecular Interaction Atlas (MIA) of This DOT

50 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Melanoma DIS1RRCY Definitive Biomarker [1]
Acute myelogenous leukaemia DISCSPTN Strong Biomarker [2]
Adult glioblastoma DISVP4LU Strong Biomarker [3]
Advanced cancer DISAT1Z9 Strong Biomarker [4]
Alzheimer disease DISF8S70 Strong Biomarker [5]
Amyotrophic lateral sclerosis DISF7HVM Strong Genetic Variation [6]
Arteriosclerosis DISK5QGC Strong Biomarker [7]
Atherosclerosis DISMN9J3 Strong Biomarker [7]
Breast cancer DIS7DPX1 Strong Biomarker [8]
Breast carcinoma DIS2UE88 Strong Biomarker [8]
Carcinoma DISH9F1N Strong Genetic Variation [9]
Carcinoma of liver and intrahepatic biliary tract DIS8WA0W Strong Altered Expression [10]
Cervical cancer DISFSHPF Strong Biomarker [11]
Cervical carcinoma DIST4S00 Strong Biomarker [11]
Clear cell renal carcinoma DISBXRFJ Strong Biomarker [12]
Colon cancer DISVC52G Strong Biomarker [13]
Colon carcinoma DISJYKUO Strong Biomarker [13]
Congestive heart failure DIS32MEA Strong Genetic Variation [14]
Diabetic kidney disease DISJMWEY Strong Biomarker [15]
Endometriosis DISX1AG8 Strong Biomarker [16]
Epithelial ovarian cancer DIS56MH2 Strong Altered Expression [17]
Esophageal cancer DISGB2VN Strong Altered Expression [18]
Frontotemporal dementia DISKYHXL Strong Biomarker [19]
Glioblastoma multiforme DISK8246 Strong Biomarker [3]
Glioma DIS5RPEH Strong Biomarker [20]
Head-neck squamous cell carcinoma DISF7P24 Strong Biomarker [21]
Hepatocellular carcinoma DIS0J828 Strong Altered Expression [22]
Liver cancer DISDE4BI Strong Altered Expression [23]
Liver cirrhosis DIS4G1GX Strong Altered Expression [10]
Lung cancer DISCM4YA Strong Biomarker [4]
Lung carcinoma DISTR26C Strong Biomarker [4]
Lung neoplasm DISVARNB Strong Altered Expression [24]
Neoplasm DISZKGEW Strong Biomarker [25]
Nervous system inflammation DISB3X5A Strong Biomarker [26]
Non-alcoholic fatty liver disease DISDG1NL Strong Biomarker [27]
Non-small-cell lung cancer DIS5Y6R9 Strong Altered Expression [28]
Ovarian cancer DISZJHAP Strong Altered Expression [17]
Ovarian neoplasm DISEAFTY Strong Altered Expression [17]
Prostate cancer DISF190Y Strong Biomarker [29]
Prostate carcinoma DISMJPLE Strong Biomarker [29]
Renal cell carcinoma DISQZ2X8 Strong Biomarker [12]
Squamous cell carcinoma DISQVIFL Strong Biomarker [30]
Stomach cancer DISKIJSX Strong Biomarker [31]
Bladder cancer DISUHNM0 moderate Biomarker [32]
Teratoma DIS6ICY4 moderate Altered Expression [33]
Urinary bladder cancer DISDV4T7 moderate Biomarker [32]
Colorectal carcinoma DIS5PYL0 Limited Biomarker [4]
Fragile X syndrome DISE8W3A Limited Altered Expression [34]
Pancreatic cancer DISJC981 Limited Biomarker [35]
Parkinson disease DISQVHKL Limited Biomarker [36]
------------------------------------------------------------------------------------
⏷ Show the Full List of 50 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
12 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the expression of RNA-binding protein PNO1 (PNO1). [37]
Ciclosporin DMAZJFX Approved Ciclosporin increases the expression of RNA-binding protein PNO1 (PNO1). [38]
Tretinoin DM49DUI Approved Tretinoin decreases the expression of RNA-binding protein PNO1 (PNO1). [39]
Cisplatin DMRHGI9 Approved Cisplatin decreases the expression of RNA-binding protein PNO1 (PNO1). [40]
Estradiol DMUNTE3 Approved Estradiol increases the expression of RNA-binding protein PNO1 (PNO1). [41]
Ivermectin DMDBX5F Approved Ivermectin decreases the expression of RNA-binding protein PNO1 (PNO1). [42]
Testosterone DM7HUNW Approved Testosterone increases the expression of RNA-binding protein PNO1 (PNO1). [44]
Bortezomib DMNO38U Approved Bortezomib increases the expression of RNA-binding protein PNO1 (PNO1). [45]
Bexarotene DMOBIKY Approved Bexarotene decreases the expression of RNA-binding protein PNO1 (PNO1). [46]
Urethane DM7NSI0 Phase 4 Urethane decreases the expression of RNA-binding protein PNO1 (PNO1). [47]
GSK2110183 DMZHB37 Phase 2 GSK2110183 decreases the expression of RNA-binding protein PNO1 (PNO1). [48]
Bisphenol A DM2ZLD7 Investigative Bisphenol A decreases the expression of RNA-binding protein PNO1 (PNO1). [49]
------------------------------------------------------------------------------------
⏷ Show the Full List of 12 Drug(s)
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Arsenic DMTL2Y1 Approved Arsenic affects the methylation of RNA-binding protein PNO1 (PNO1). [43]
------------------------------------------------------------------------------------

References

1 Extracellular vesicle-dependent effect of RNA-binding protein IGF2BP1 on melanoma metastasis.Oncogene. 2019 May;38(21):4182-4196. doi: 10.1038/s41388-019-0797-3. Epub 2019 Apr 1.
2 Targeting an RNA-Binding Protein Network in Acute Myeloid Leukemia.Cancer Cell. 2019 Mar 18;35(3):369-384.e7. doi: 10.1016/j.ccell.2019.01.010. Epub 2019 Feb 21.
3 RNA-Binding Protein Musashi1 Is a Central Regulator of Adhesion Pathways in Glioblastoma.Mol Cell Biol. 2015 Sep 1;35(17):2965-78. doi: 10.1128/MCB.00410-15. Epub 2015 Jun 22.
4 EBF1-Mediated Upregulation of Ribosome Assembly Factor PNO1 Contributes to Cancer Progression by Negatively Regulating the p53 Signaling Pathway.Cancer Res. 2019 May 1;79(9):2257-2270. doi: 10.1158/0008-5472.CAN-18-3238. Epub 2019 Mar 12.
5 Amyloid precursor protein, an androgen-regulated gene, is targeted by RNA-binding protein PSF/SFPQ in neuronal cells.Genes Cells. 2019 Nov;24(11):719-730. doi: 10.1111/gtc.12721. Epub 2019 Oct 15.
6 Single-copy expression of an amyotrophic lateral sclerosis-linked TDP-43 mutation (M337V) in BAC transgenic mice leads to altered stress granule dynamics and progressive motor dysfunction.Neurobiol Dis. 2019 Jan;121:148-162. doi: 10.1016/j.nbd.2018.09.024. Epub 2018 Oct 2.
7 Endothelial HuR deletion reduces the expression of proatherogenic molecules and attenuates atherosclerosis.Int Immunopharmacol. 2018 Dec;65:248-255. doi: 10.1016/j.intimp.2018.09.023. Epub 2018 Oct 17.
8 Cell type-restricted activity of hnRNPM promotes breast cancer metastasis via regulating alternative splicing.Genes Dev. 2014 Jun 1;28(11):1191-203. doi: 10.1101/gad.241968.114. Epub 2014 May 19.
9 Role of the RNA-binding protein HuR in colon carcinogenesis.Oncogene. 2003 Oct 16;22(46):7146-54. doi: 10.1038/sj.onc.1206862.
10 Aberrant expression of fetal RNA-binding protein p62 in liver cancer and liver cirrhosis.Am J Pathol. 2001 Sep;159(3):945-53. doi: 10.1016/S0002-9440(10)61770-1.
11 Msi1 promotes tumor growth and cell proliferation by targeting cell cycle checkpoint proteins p21, p27 and p53 in cervical carcinomas.Oncotarget. 2014 Nov 15;5(21):10870-85. doi: 10.18632/oncotarget.2539.
12 Role of the RNA-binding protein HuR in human renal cell carcinoma.Carcinogenesis. 2010 Jun;31(6):1018-26. doi: 10.1093/carcin/bgq052. Epub 2010 Mar 10.
13 RNA-binding protein quaking, a critical regulator of colon epithelial differentiation and a suppressor of colon cancer.Gastroenterology. 2010 Jan;138(1):231-40.e1-5. doi: 10.1053/j.gastro.2009.08.001. Epub 2009 Aug 15.
14 RNA-binding protein RBM20 represses splicing to orchestrate cardiac pre-mRNA processing.J Clin Invest. 2014 Aug;124(8):3419-30. doi: 10.1172/JCI74523. Epub 2014 Jun 24.
15 Identification of NOD2 as a novel target of RNA-binding protein HuR: evidence from NADPH oxidase-mediated HuR signaling in diabetic nephropathy.Free Radic Biol Med. 2015 Feb;79:217-27. doi: 10.1016/j.freeradbiomed.2014.12.013. Epub 2014 Dec 18.
16 A balancing act: RNA binding protein HuR/TTP axis in endometriosis patients.Sci Rep. 2017 Jul 19;7(1):5883. doi: 10.1038/s41598-017-06081-7.
17 Identification of clinical trait-related lncRNA and mRNA biomarkers with weighted gene co-expression network analysis as useful tool for personalized medicine in ovarian cancer.EPMA J. 2019 Jul 19;10(3):273-290. doi: 10.1007/s13167-019-00175-0. eCollection 2019 Sep.
18 The RNA-binding protein CUG-BP1 increases survivin expression in oesophageal cancer cells through enhanced mRNA stability.Biochem J. 2012 Aug 15;446(1):113-23. doi: 10.1042/BJ20120112.
19 Functional and dynamic polymerization of the ALS-linked protein TDP-43 antagonizes its pathologic aggregation.Nat Commun. 2017 Jun 29;8(1):45. doi: 10.1038/s41467-017-00062-0.
20 Hu antigen R (HuR) multimerization contributes to glioma disease progression.J Biol Chem. 2017 Oct 13;292(41):16999-17010. doi: 10.1074/jbc.M117.797878. Epub 2017 Aug 8.
21 Characterization of squamous cell carcinoma in an organotypic culture via subsurface non-linear optical molecular imaging.Exp Biol Med (Maywood). 2013 Nov 1;238(11):1233-41. doi: 10.1177/1535370213502628. Epub 2013 Oct 1.
22 Lin28b is involved in curcumin-reversed paclitaxel chemoresistance and associated with poor prognosis in hepatocellular carcinoma.J Cancer. 2019 Oct 15;10(24):6074-6087. doi: 10.7150/jca.33421. eCollection 2019.
23 RBMY, a male germ cell-specific RNA-binding protein, activated in human liver cancers and transforms rodent fibroblasts.Oncogene. 2004 Jul 29;23(34):5815-22. doi: 10.1038/sj.onc.1207773.
24 Expression of the RNA-binding protein CRD-BP in brain and non-small cell lung tumors.Cancer Lett. 2004 Jun 25;209(2):245-50. doi: 10.1016/j.canlet.2003.12.015.
25 Multiple functions of HuR in urinary tumors.J Cancer Res Clin Oncol. 2019 Jan;145(1):11-18. doi: 10.1007/s00432-018-2778-2. Epub 2018 Oct 28.
26 Dysfunctional RNA-binding protein biology and neurodegeneration in experimental autoimmune encephalomyelitis in female mice.J Neurosci Res. 2020 Apr;98(4):704-717. doi: 10.1002/jnr.24554. Epub 2019 Nov 22.
27 SIRT1 mediates the role of RNA-binding protein QKI 5 in the synthesis of triglycerides in non-alcoholic fatty liver disease mice via the PPAR/FoxO1 signaling pathway.Int J Mol Med. 2019 Mar;43(3):1271-1280. doi: 10.3892/ijmm.2019.4059. Epub 2019 Jan 10.
28 The RNA-binding protein HuR stabilizes cytosolic phospholipase A2 mRNA under interleukin-1 treatment in non-small cell lung cancer A549 Cells.J Biol Chem. 2011 Oct 14;286(41):35499-35508. doi: 10.1074/jbc.M111.263582. Epub 2011 Aug 23.
29 The RNA-binding protein FXR1 modulates prostate cancer progression by regulating FBXO4.Funct Integr Genomics. 2019 May;19(3):487-496. doi: 10.1007/s10142-019-00661-8. Epub 2019 Feb 11.
30 Repression of caspase-3 and RNA-binding protein HuR cleavage by cyclooxygenase-2 promotes drug resistance in oral squamous cell carcinoma.Oncogene. 2017 Jun 1;36(22):3137-3148. doi: 10.1038/onc.2016.451. Epub 2016 Dec 12.
31 The RNA-binding protein PCBP2 facilitates gastric carcinoma growth by targeting miR-34a.Biochem Biophys Res Commun. 2014 Jun 13;448(4):437-42. doi: 10.1016/j.bbrc.2014.04.124. Epub 2014 May 2.
32 Importance of PNO1 for growth and survival of urinary bladder carcinoma: Role in core-regulatory circuitry.J Cell Mol Med. 2020 Jan;24(2):1504-1515. doi: 10.1111/jcmm.14835. Epub 2019 Dec 4.
33 Mammalian germ cells are determined after PGC colonization of the nascent gonad.Proc Natl Acad Sci U S A. 2019 Dec 17;116(51):25677-25687. doi: 10.1073/pnas.1910733116. Epub 2019 Nov 21.
34 Fragile X Syndrome: from molecular pathology to therapy.Neurosci Biobehav Rev. 2014 Oct;46 Pt 2:242-55. doi: 10.1016/j.neubiorev.2014.01.006. Epub 2014 Jan 22.
35 Identification of Upregulated HNRNPs Associated with Poor Prognosis in Pancreatic Cancer.Biomed Res Int. 2019 Jul 4;2019:5134050. doi: 10.1155/2019/5134050. eCollection 2019.
36 Association between the neuron-specific RNA-binding protein ELAVL4 and Parkinson disease.Hum Genet. 2005 Jun;117(1):27-33. doi: 10.1007/s00439-005-1259-2. Epub 2005 Apr 13.
37 Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
38 Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
39 Phenotypic characterization of retinoic acid differentiated SH-SY5Y cells by transcriptional profiling. PLoS One. 2013 May 28;8(5):e63862.
40 Low doses of cisplatin induce gene alterations, cell cycle arrest, and apoptosis in human promyelocytic leukemia cells. Biomark Insights. 2016 Aug 24;11:113-21.
41 17-Estradiol Activates HSF1 via MAPK Signaling in ER-Positive Breast Cancer Cells. Cancers (Basel). 2019 Oct 11;11(10):1533. doi: 10.3390/cancers11101533.
42 Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
43 Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
44 The exosome-like vesicles derived from androgen exposed-prostate stromal cells promote epithelial cells proliferation and epithelial-mesenchymal transition. Toxicol Appl Pharmacol. 2021 Jan 15;411:115384. doi: 10.1016/j.taap.2020.115384. Epub 2020 Dec 25.
45 The proapoptotic effect of zoledronic acid is independent of either the bone microenvironment or the intrinsic resistance to bortezomib of myeloma cells and is enhanced by the combination with arsenic trioxide. Exp Hematol. 2011 Jan;39(1):55-65.
46 Identification of biomarkers modulated by the rexinoid LGD1069 (bexarotene) in human breast cells using oligonucleotide arrays. Cancer Res. 2006 Dec 15;66(24):12009-18.
47 Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
48 Novel ATP-competitive Akt inhibitor afuresertib suppresses the proliferation of malignant pleural mesothelioma cells. Cancer Med. 2017 Nov;6(11):2646-2659. doi: 10.1002/cam4.1179. Epub 2017 Sep 27.
49 Gene expression profiling analysis of bisphenol A-induced perturbation in biological processes in ER-negative HEK293 cells. PLoS One. 2014 Jun 5;9(6):e98635.