Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT251CI0)

• DOT Name: Cyclic AMP-dependent transcription factor ATF-1 (ATF1)
• Synonyms: cAMP-dependent transcription factor ATF-1; Activating transcription factor 1; Protein TREB36
• Gene Name: ATF1
• Related Disease:
  Melanoma
  Neoplasm
  Adult glioblastoma
  Breast neoplasm
  Cervical cancer
  Cervical carcinoma
  Classic Hodgkin lymphoma
  Colon cancer
  Colorectal adenocarcinoma
  Colorectal adenoma
  Colorectal cancer
  Colorectal cancer, susceptibility to, 1
  Colorectal cancer, susceptibility to, 10
  Colorectal cancer, susceptibility to, 12
  Colorectal carcinoma
  Colorectal neoplasm
  Dilated cardiomyopathy 1A
  Essential hypertension
  Glioblastoma multiforme
  Hepatocellular carcinoma
  Lung cancer
  Lung carcinoma
  Malignant mesothelioma
  Metastatic melanoma
  Non-small-cell lung cancer
  Polycystic kidney disease
  Polycystic ovarian syndrome
  Sarcoma
  Soft tissue sarcoma
  Thyroid cancer
  Thyroid gland carcinoma
  Thyroid gland papillary carcinoma
  Thyroid tumor
  Carcinoma
  Clear cell adenocarcinoma
  Nasopharyngeal carcinoma
  Neuroblastoma
  Recessive X-linked ichthyosis
  Malignant soft tissue neoplasm
  Acute myelogenous leukaemia
  Advanced cancer
  Cutaneous melanoma
  Digestive system neoplasm
• UniProt ID: ATF1_HUMAN
• Pfam ID: PF00170 ; PF02173
• Sequence:
  MEDSHKSTTSETAPQPGSAVQGAHISHIAQQVSSLSESEESQDSSDSIGSSQKAHGILAR
  RPSYRKILKDLSSEDTRGRKGDGENSGVSAAVTSMSVPTPIYQTSSGQYIAIAPNGALQL
  ASPGTDGVQGLQTLTMTNSGSTQQGTTILQYAQTSDGQQILVPSNQVVVQTASGDMQTYQ
  IRTTPSATSLPQTVVMTSPVTLTSQTTKTDDPQLKREIRLMKNREAARECRRKKKEYVKC
  LENRVAVLENQNKTLIEELKTLKDLYSNKSV
• Function: This protein binds the cAMP response element (CRE) (consensus: 5'-GTGACGT[AC][AG]-3'), a sequence present in many viral and cellular promoters. Binds to the Tax-responsive element (TRE) of HTLV-I. Mediates PKA-induced stimulation of CRE-reporter genes. Represses the expression of FTH1 and other antioxidant detoxification genes. Triggers cell proliferation and transformation.
• KEGG Pathway:
  Aldosterone synthesis and secretion (hsa04925)
  Transcriptio.l misregulation in cancer (hsa05202)
• Reactome Pathway:
  NGF-stimulated transcription (R-HSA-9031628)
  CREB phosphorylation (R-HSA-199920)

Molecular Interaction Atlas (MIA) of This DOT

43 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Melanoma	DIS1RRCY	Definitive	Altered Expression	[1]
Neoplasm	DISZKGEW	Definitive	Biomarker	[2]
Adult glioblastoma	DISVP4LU	Strong	Altered Expression	[3]
Breast neoplasm	DISNGJLM	Strong	Altered Expression	[4]
Cervical cancer	DISFSHPF	Strong	Biomarker	[2]
Cervical carcinoma	DIST4S00	Strong	Biomarker	[2]
Classic Hodgkin lymphoma	DISV1LU6	Strong	Genetic Variation	[5]
Colon cancer	DISVC52G	Strong	Genetic Variation	[6]
Colorectal adenocarcinoma	DISPQOUB	Strong	Genetic Variation	[6]
Colorectal adenoma	DISTSVHM	Strong	Genetic Variation	[6]
Colorectal cancer	DISNH7P9	Strong	Genetic Variation	[6]
Colorectal cancer, susceptibility to, 1	DISZ794C	Strong	Genetic Variation	[6]
Colorectal cancer, susceptibility to, 10	DISQXMYM	Strong	Genetic Variation	[6]
Colorectal cancer, susceptibility to, 12	DIS4FXJX	Strong	Genetic Variation	[6]
Colorectal carcinoma	DIS5PYL0	Strong	Genetic Variation	[6]
Colorectal neoplasm	DISR1UCN	Strong	Genetic Variation	[6]
Dilated cardiomyopathy 1A	DIS0RK9Z	Strong	Altered Expression	[7]
Essential hypertension	DIS7WI98	Strong	Genetic Variation	[8]
Glioblastoma multiforme	DISK8246	Strong	Altered Expression	[3]
Hepatocellular carcinoma	DIS0J828	Strong	Biomarker	[9]
Lung cancer	DISCM4YA	Strong	Posttranslational Modification	[10]
Lung carcinoma	DISTR26C	Strong	Posttranslational Modification	[10]
Malignant mesothelioma	DISTHJGH	Strong	Biomarker	[11]
Metastatic melanoma	DISSL43L	Strong	Biomarker	[12]
Non-small-cell lung cancer	DIS5Y6R9	Strong	Biomarker	[13]
Polycystic kidney disease	DISWS3UY	Strong	Biomarker	[14]
Polycystic ovarian syndrome	DISZ2BNG	Strong	Biomarker	[15]
Sarcoma	DISZDG3U	Strong	Altered Expression	[16]
Soft tissue sarcoma	DISSN8XB	Strong	Biomarker	[17]
Thyroid cancer	DIS3VLDH	Strong	Altered Expression	[18]
Thyroid gland carcinoma	DISMNGZ0	Strong	Altered Expression	[18]
Thyroid gland papillary carcinoma	DIS48YMM	Strong	Altered Expression	[18]
Thyroid tumor	DISLVKMD	Strong	Altered Expression	[18]
Carcinoma	DISH9F1N	moderate	Genetic Variation	[19]
Clear cell adenocarcinoma	DISYUGHZ	moderate	Biomarker	[20]
Nasopharyngeal carcinoma	DISAOTQ0	moderate	Genetic Variation	[21]
Neuroblastoma	DISVZBI4	moderate	Altered Expression	[22]
Recessive X-linked ichthyosis	DISZY56W	moderate	Genetic Variation	[23]
Malignant soft tissue neoplasm	DISTC6NO	Disputed	Altered Expression	[16]
Acute myelogenous leukaemia	DISCSPTN	Limited	Genetic Variation	[24]
Advanced cancer	DISAT1Z9	Limited	Genetic Variation	[25]
Cutaneous melanoma	DIS3MMH9	Limited	Genetic Variation	[26]
Digestive system neoplasm	DISPOJCT	Limited	Biomarker	[26]

10 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Cyclic AMP-dependent transcription factor ATF-1 (ATF1).	[27]
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Cyclic AMP-dependent transcription factor ATF-1 (ATF1).	[28]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Cyclic AMP-dependent transcription factor ATF-1 (ATF1).	[29]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of Cyclic AMP-dependent transcription factor ATF-1 (ATF1).	[30]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide decreases the expression of Cyclic AMP-dependent transcription factor ATF-1 (ATF1).	[32]
Vorinostat	DMWMPD4	Approved	Vorinostat decreases the expression of Cyclic AMP-dependent transcription factor ATF-1 (ATF1).	[27]
Pelitinib	DMIW453	Phase 2	Pelitinib decreases the expression of Cyclic AMP-dependent transcription factor ATF-1 (ATF1).	[35]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Cyclic AMP-dependent transcription factor ATF-1 (ATF1).	[36]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A decreases the expression of Cyclic AMP-dependent transcription factor ATF-1 (ATF1).	[37]
Milchsaure	DM462BT	Investigative	Milchsaure increases the expression of Cyclic AMP-dependent transcription factor ATF-1 (ATF1).	[39]

6 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Quercetin	DM3NC4M	Approved	Quercetin increases the phosphorylation of Cyclic AMP-dependent transcription factor ATF-1 (ATF1).	[31]
Dinoprostone	DMTYOPD	Approved	Dinoprostone increases the phosphorylation of Cyclic AMP-dependent transcription factor ATF-1 (ATF1).	[33]
Resveratrol	DM3RWXL	Phase 3	Resveratrol increases the phosphorylation of Cyclic AMP-dependent transcription factor ATF-1 (ATF1).	[34]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde increases the phosphorylation of Cyclic AMP-dependent transcription factor ATF-1 (ATF1).	[38]
BRN-3548355	DM4KXT0	Investigative	BRN-3548355 increases the phosphorylation of Cyclic AMP-dependent transcription factor ATF-1 (ATF1).	[40]
xamoterol	DMOVJP3	Investigative	xamoterol increases the phosphorylation of Cyclic AMP-dependent transcription factor ATF-1 (ATF1).	[40]

References

• [1] Transcriptional control of melanoma metastasis: the importance of the tumor microenvironment.Semin Cancer Biol. 2011 Apr;21(2):83-8. doi: 10.1016/j.semcancer.2010.12.007. Epub 2010 Dec 13.
• [2] Long non-coding RNA RP11-552M11.4 favors tumorigenesis and development of cervical cancer via modulating miR-3941/ATF1 signaling.Int J Biol Macromol. 2019 Jun 1;130:24-33. doi: 10.1016/j.ijbiomac.2019.02.083. Epub 2019 Feb 18.
• [3] Cyclin-dependent kinase 3-mediated activating transcription factor 1 phosphorylation enhances cell transformation.Cancer Res. 2008 Sep 15;68(18):7650-60. doi: 10.1158/0008-5472.CAN-08-1137.
• [4] Leptin enhances, via AP-1, expression of aromatase in the MCF-7 cell line.J Biol Chem. 2003 Aug 1;278(31):28668-76. doi: 10.1074/jbc.M301695200. Epub 2003 May 6.
• [5] Analysis of the Epstein-Barr virus (EBV) latent membrane protein 1 (LMP-1) gene and promoter in Hodgkin's disease isolates: selection against EBV variants with mutations in the LMP-1 promoter ATF-1/CREB-1 binding site.Mol Pathol. 2000 Oct;53(5):280-8. doi: 10.1136/mp.53.5.280.
• [6] Discovery of common and rare genetic risk variants for colorectal cancer.Nat Genet. 2019 Jan;51(1):76-87. doi: 10.1038/s41588-018-0286-6. Epub 2018 Dec 3.
• [7] Gene expression analysis in human breast cancer associated blood vessels.PLoS One. 2012;7(10):e44294. doi: 10.1371/journal.pone.0044294. Epub 2012 Oct 2.
• [8] The human ATF1 rs11169571 polymorphism increases essential hypertension risk through modifying miRNA binding.FEBS Lett. 2015 Jul 22;589(16):2087-93. doi: 10.1016/j.febslet.2015.06.029. Epub 2015 Jul 3.
• [9] LncRNA GHET1 activated by H3K27 acetylation promotes cell tumorigenesis through regulating ATF1 in hepatocellular carcinoma.Biomed Pharmacother. 2017 Oct;94:326-331. doi: 10.1016/j.biopha.2017.07.046. Epub 2017 Jul 31.
• [10] Activating transcription factor 1 promoted migration and invasion in lung cancer cells through regulating EGFR and MMP-2.Mol Carcinog. 2019 Oct;58(10):1919-1924. doi: 10.1002/mc.23086. Epub 2019 Aug 16.
• [11] A Subset of Malignant Mesotheliomas in Young Adults Are Associated With Recurrent EWSR1/FUS-ATF1 Fusions.Am J Surg Pathol. 2017 Jul;41(7):980-988. doi: 10.1097/PAS.0000000000000864.
• [12] Diagnosis of clear cell sarcoma by real-time reverse transcriptase-polymerase chain reaction analysis of paraffin embedded tissues: clinicopathologic and molecular analysis of 44 patients from the French sarcoma group.Cancer. 2006 Sep 1;107(5):1055-64. doi: 10.1002/cncr.22099.
• [13] miR-30a radiosensitizes non-small cell lung cancer by targeting ATF1 that is involved in the phosphorylation of ATM.Oncol Rep. 2017 Apr;37(4):1980-1988. doi: 10.3892/or.2017.5448. Epub 2017 Feb 14.
• [14] Cyclic nucleotide signaling in polycystic kidney disease.Kidney Int. 2010 Jan;77(2):129-40. doi: 10.1038/ki.2009.438. Epub 2009 Nov 18.
• [15] Progesterone resistance in PCOS endometrium: a microarray analysis in clomiphene citrate-treated and artificial menstrual cycles.J Clin Endocrinol Metab. 2011 Jun;96(6):1737-46. doi: 10.1210/jc.2010-2600. Epub 2011 Mar 16.
• [16] Cell-type dependent enhancer binding of the EWS/ATF1 fusion gene in clear cell sarcomas.Nat Commun. 2019 Sep 5;10(1):3999. doi: 10.1038/s41467-019-11745-1.
• [17] Fusion of the EWSR1 and ATF1 genes without expression of the MITF-M transcript in angiomatoid fibrous histiocytoma.Genes Chromosomes Cancer. 2005 Sep;44(1):97-102. doi: 10.1002/gcc.20201.
• [18] Activating transcription factor-1-mediated hepatocyte growth factor-induced down-regulation of thrombospondin-1 expression leads to thyroid cancer cell invasion.J Biol Chem. 2007 May 25;282(21):15490-7. doi: 10.1074/jbc.M610586200. Epub 2007 Apr 4.
• [19] EWSR1 translocation in primary hyalinising clear cell carcinoma of the thymus.Histopathology. 2019 Sep;75(3):431-436. doi: 10.1111/his.13890. Epub 2019 Jul 19.
• [20] Hyalinizing clear cell carcinoma of the bronchial glands: presentation of three cases and pathological comparisons with salivary gland counterparts and bronchial mucoepidermoid carcinomas.Mod Pathol. 2018 Jun;31(6):923-933. doi: 10.1038/s41379-018-0025-7. Epub 2018 Feb 12.
• [21] The human ATF1 rs11169571 polymorphism associated with risk of nasopharyngeal carcinoma in Southern Chinese populations.Cancer Med. 2019 Apr;8(4):1893-1898. doi: 10.1002/cam4.2022. Epub 2019 Mar 23.
• [22] The promoter of human acetylcholinesterase is activated by a cyclic adenosine 3',5'-monophosphate-dependent pathway in cultured NG108-15 neuroblastoma cells.Neurosci Lett. 2000 Jul 7;288(1):81-5. doi: 10.1016/s0304-3940(00)01200-3.
• [23] Classification of clear-cell sarcoma as a subtype of melanoma by genomic profiling.J Clin Oncol. 2003 May 1;21(9):1775-81. doi: 10.1200/JCO.2003.10.108.
• [24] Fusion of the FUS and BBF2H7 genes in low grade fibromyxoid sarcoma.Hum Mol Genet. 2003 Sep 15;12(18):2349-58. doi: 10.1093/hmg/ddg237. Epub 2003 Jul 22.
• [25] Systematic Functional Interrogation of Genes in GWAS Loci Identified ATF1 as a Key Driver in Colorectal Cancer Modulated by a Promoter-Enhancer Interaction.Am J Hum Genet. 2019 Jul 3;105(1):29-47. doi: 10.1016/j.ajhg.2019.05.004. Epub 2019 Jun 13.
• [26] EWS-ATF1 fusion transcripts in gastrointestinal tumors previously diagnosed as malignant melanoma.Hum Pathol. 2005 Jan;36(1):74-81. doi: 10.1016/j.humpath.2004.10.015.
• [27] A genomic approach to predict synergistic combinations for breast cancer treatment. Pharmacogenomics J. 2013 Feb;13(1):94-104. doi: 10.1038/tpj.2011.48. Epub 2011 Nov 15.
• [28] Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
• [29] Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
• [30] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [31] Quercetin potentiates UVB-Induced c-Fos expression: implications for its use as a chemopreventive agent. Cancer Prev Res (Phila). 2010 Jul;3(7):876-84. doi: 10.1158/1940-6207.CAPR-09-0220. Epub 2010 Jun 15.
• [32] Oxidative stress modulates theophylline effects on steroid responsiveness. Biochem Biophys Res Commun. 2008 Dec 19;377(3):797-802.
• [33] Ketoconazole suppresses prostaglandin E(2)-induced cyclooxygenase-2 expression in human epidermoid carcinoma A-431 cells. J Invest Dermatol. 2002 Jul;119(1):174-81.
• [34] AMP-activated protein kinase signaling activation by resveratrol modulates amyloid-beta peptide metabolism. J Biol Chem. 2010 Mar 19;285(12):9100-13. doi: 10.1074/jbc.M109.060061. Epub 2010 Jan 14.
• [35] Irreversible EGFR inhibitor EKB-569 targets low-LET -radiation-triggered rel orchestration and potentiates cell death in squamous cell carcinoma. PLoS One. 2011;6(12):e29705. doi: 10.1371/journal.pone.0029705. Epub 2011 Dec 29.
• [36] Targeting MYCN in neuroblastoma by BET bromodomain inhibition. Cancer Discov. 2013 Mar;3(3):308-23.
• [37] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [38] MAPK- and PKC/CREB-dependent induction of interleukin-11 by the environmental contaminant formaldehyde in human bronchial epithelial cells. Toxicology. 2012 Feb 6;292(1):13-22. doi: 10.1016/j.tox.2011.11.011. Epub 2011 Nov 28.
• [39] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
• [40] NNK activates ERK1/2 and CREB/ATF-1 via beta-1-AR and EGFR signaling in human lung adenocarcinoma and small airway epithelial cells. Int J Cancer. 2006 Oct 1;119(7):1547-52. doi: 10.1002/ijc.21987.