Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT3G4GBZ)

• DOT Name: Arginine-glutamic acid dipeptide repeats protein (RERE)
• Synonyms: Atrophin-1-like protein; Atrophin-1-related protein
• Gene Name: RERE
• Related Disease:
  Cardiomyopathy
  Complex neurodevelopmental disorder with or without congenital anomalies
  Type-1/2 diabetes
  Advanced cancer
  Attention deficit hyperactivity disorder
  Autism spectrum disorder
  B-cell neoplasm
  Bipolar disorder
  Burkitt lymphoma
  Carcinoma of esophagus
  Cardiovascular disease
  Esophageal cancer
  Esophageal squamous cell carcinoma
  Follicular lymphoma
  Hepatitis B virus infection
  Hepatitis C virus infection
  Juvenile idiopathic arthritis
  Major depressive disorder
  Mastocytosis
  Matthew-Wood syndrome
  MELAS syndrome
  Mental disorder
  Mitochondrial DNA depletion syndrome 4a
  Mitochondrial encephalomyopathy
  Mood disorder
  Myeloid leukaemia
  Neoplasm of esophagus
  Neurodevelopmental disorder with or without anomalies of the brain, eye, or heart
  Pancreatic cancer
  Pancreatitis
  Pervasive developmental disorder
  Promyelocytic leukaemia
  Schizophrenia
  Sensorineural hearing loss disorder
  Ventricular septal defect
  Vitiligo
  Allergic rhinitis
  CHARGE syndrome
  Coronary heart disease
  Gastroparesis
  Asthma
  Chronic obstructive pulmonary disease
  leukaemia
  Leukemia
  Syphilis
  Venous thromboembolism
• UniProt ID: RERE_HUMAN
• PDB ID: 2YQK
• Pfam ID: PF03154 ; PF01426 ; PF01448 ; PF00320
• Sequence:
  MTADKDKDKDKEKDRDRDRDREREKRDKARESENSRPRRSCTLEGGAKNYAESDHSEDED
  NDNNSATAEESTKKNKKKPPKKKSRYERTDTGEITSYITEDDVVYRPGDCVYIESRRPNT
  PYFICSIQDFKLVHNSQACCRSPTPALCDPPACSLPVASQPPQHLSEAGRGPVGSKRDHL
  LMNVKWYYRQSEVPDSVYQHLVQDRHNENDSGRELVITDPVIKNRELFISDYVDTYHAAA
  LRGKCNISHFSDIFAAREFKARVDSFFYILGYNPETRRLNSTQGEIRVGPSHQAKLPDLQ
  PFPSPDGDTVTQHEELVWMPGVNDCDLLMYLRAARSMAAFAGMCDGGSTEDGCVAASRDD
  TTLNALNTLHESGYDAGKALQRLVKKPVPKLIEKCWTEDEVKRFVKGLRQYGKNFFRIRK
  ELLPNKETGELITFYYYWKKTPEAASSRAHRRHRRQAVFRRIKTRTASTPVNTPSRPPSS
  EFLDLSSASEDDFDSEDSEQELKGYACRHCFTTTSKDWHHGGRENILLCTDCRIHFKKYG
  ELPPIEKPVDPPPFMFKPVKEEDDGLSGKHSMRTRRSRGSMSTLRSGRKKQPASPDGRTS
  PINEDIRSSGRNSPSAASTSSNDSKAETVKKSAKKVKEEASSPLKSNKRQREKVASDTEE
  ADRTSSKKTKTQEISRPNSPSEGEGESSDSRSVNDEGSSDPKDIDQDNRSTSPSIPSPQD
  NESDSDSSAQQQMLQAQPPALQAPTGVTPAPSSAPPGTPQLPTPGPTPSATAVPPQGSPT
  ASQAPNQPQAPTAPVPHTHIQQAPALHPQRPPSPHPPPHPSPHPPLQPLTGSAGQPSAPS
  HAQPPLHGQGPPGPHSLQAGPLLQHPGPPQPFGLPPQASQGQAPLGTSPAAAYPHTSLQL
  PASQSALQSQQPPREQPLPPAPLAMPHIKPPPTTPIPQLPAPQAHKHPPHLSGPSPFSMN
  ANLPPPPALKPLSSLSTHHPPSAHPPPLQLMPQSQPLPSSPAQPPGLTQSQNLPPPPASH
  PPTGLHQVAPQPPFAQHPFVPGGPPPITPPTCPSTSTPPAGPGTSAQPPCSGAAASGGSI
  AGGSSCPLPTVQIKEEALDDAEEPESPPPPPRSPSPEPTVVDTPSHASQSARFYKHLDRG
  YNSCARTDLYFMPLAGSKLAKKREEAIEKAKREAEQKAREEREREKEKEKERERERERER
  EAERAAKASSSAHEGRLSDPQLSGPGHMRPSFEPPPTTIAAVPPYIGPDTPALRTLSEYA
  RPHVMSPTNRNHPFYMPLNPTDPLLAYHMPGLYNVDPTIRERELREREIREREIRERELR
  ERMKPGFEVKPPELDPLHPAANPMEHFARHSALTIPPTAGPHPFASFHPGLNPLERERLA
  LAGPQLRPEMSYPDRLAAERIHAERMASLTSDPLARLQMFNVTPHHHQHSHIHSHLHLHQ
  QDPLHQGSAGPVHPLVDPLTAGPHLARFPYPPGTLPNPLLGQPPHEHEMLRHPVFGTPYP
  RDLPGAIPPPMSAAHQLQAMHAQSAELQRLAMEQQWLHGHPHMHGGHLPSQEDYYSRLKK
  EGDKQL
• Function: Plays a role as a transcriptional repressor during development. May play a role in the control of cell survival. Overexpression of RERE recruits BAX to the nucleus particularly to POD and triggers caspase-3 activation, leading to cell death.
• Tissue Specificity: Widely expressed. Expressed in tumor cell lines.

Molecular Interaction Atlas (MIA) of This DOT

46 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Cardiomyopathy	DISUPZRG	Definitive	Biomarker	[1]
Complex neurodevelopmental disorder with or without congenital anomalies	DISG5D0C	Definitive	Autosomal dominant	[2]
Type-1/2 diabetes	DISIUHAP	Definitive	Altered Expression	[3]
Advanced cancer	DISAT1Z9	Strong	Biomarker	[4]
Attention deficit hyperactivity disorder	DISL8MX9	Strong	Genetic Variation	[5]
Autism spectrum disorder	DISXK8NV	Strong	Genetic Variation	[6]
B-cell neoplasm	DISVY326	Strong	Altered Expression	[7]
Bipolar disorder	DISAM7J2	Strong	Genetic Variation	[5]
Burkitt lymphoma	DIS9D5XU	Strong	Altered Expression	[7]
Carcinoma of esophagus	DISS6G4D	Strong	Genetic Variation	[8]
Cardiovascular disease	DIS2IQDX	Strong	Genetic Variation	[9]
Esophageal cancer	DISGB2VN	Strong	Genetic Variation	[8]
Esophageal squamous cell carcinoma	DIS5N2GV	Strong	Genetic Variation	[8]
Follicular lymphoma	DISVEUR6	Strong	Altered Expression	[7]
Hepatitis B virus infection	DISLQ2XY	Strong	Biomarker	[10]
Hepatitis C virus infection	DISQ0M8R	Strong	Genetic Variation	[11]
Juvenile idiopathic arthritis	DISQZGBV	Strong	Biomarker	[12]
Major depressive disorder	DIS4CL3X	Strong	Genetic Variation	[13]
Mastocytosis	DIS1TEE0	Strong	Biomarker	[14]
Matthew-Wood syndrome	DISA7HR7	Strong	Biomarker	[15]
MELAS syndrome	DIS81Z3S	Strong	Genetic Variation	[16]
Mental disorder	DIS3J5R8	Strong	Genetic Variation	[17]
Mitochondrial DNA depletion syndrome 4a	DISU4RVU	Strong	Genetic Variation	[18]
Mitochondrial encephalomyopathy	DISA6PTN	Strong	Genetic Variation	[19]
Mood disorder	DISLVMWO	Strong	Genetic Variation	[20]
Myeloid leukaemia	DISMN944	Strong	Biomarker	[14]
Neoplasm of esophagus	DISOLKAQ	Strong	Genetic Variation	[8]
Neurodevelopmental disorder with or without anomalies of the brain, eye, or heart	DIS1AW4X	Strong	Autosomal dominant	[21]
Pancreatic cancer	DISJC981	Strong	Genetic Variation	[22]
Pancreatitis	DIS0IJEF	Strong	Biomarker	[23]
Pervasive developmental disorder	DIS51975	Strong	Genetic Variation	[6]
Promyelocytic leukaemia	DISYGG13	Strong	Biomarker	[4]
Schizophrenia	DISSRV2N	Strong	Genetic Variation	[24]
Sensorineural hearing loss disorder	DISJV45Z	Strong	Genetic Variation	[25]
Ventricular septal defect	DISICO41	Strong	Biomarker	[26]
Vitiligo	DISR05SL	Strong	Genetic Variation	[27]
Allergic rhinitis	DIS3U9HN	moderate	Genetic Variation	[28]
CHARGE syndrome	DISKD3CW	moderate	Genetic Variation	[25]
Coronary heart disease	DIS5OIP1	moderate	Genetic Variation	[29]
Gastroparesis	DISDW0SR	moderate	Biomarker	[30]
Asthma	DISW9QNS	Limited	Genetic Variation	[31]
Chronic obstructive pulmonary disease	DISQCIRF	Limited	Genetic Variation	[32]
leukaemia	DISS7D1V	Limited	Biomarker	[33]
Leukemia	DISNAKFL	Limited	Biomarker	[33]
Syphilis	DISJ73BS	Limited	Genetic Variation	[34]
Venous thromboembolism	DISUR7CR	Limited	Biomarker	[35]

8 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the methylation of Arginine-glutamic acid dipeptide repeats protein (RERE).	[36]
Arsenic	DMTL2Y1	Approved	Arsenic affects the methylation of Arginine-glutamic acid dipeptide repeats protein (RERE).	[39]
Quercetin	DM3NC4M	Approved	Quercetin decreases the phosphorylation of Arginine-glutamic acid dipeptide repeats protein (RERE).	[40]
Fulvestrant	DM0YZC6	Approved	Fulvestrant increases the methylation of Arginine-glutamic acid dipeptide repeats protein (RERE).	[43]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene affects the methylation of Arginine-glutamic acid dipeptide repeats protein (RERE).	[45]
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 affects the phosphorylation of Arginine-glutamic acid dipeptide repeats protein (RERE).	[40]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the methylation of Arginine-glutamic acid dipeptide repeats protein (RERE).	[48]
Coumarin	DM0N8ZM	Investigative	Coumarin increases the phosphorylation of Arginine-glutamic acid dipeptide repeats protein (RERE).	[40]

8 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Arginine-glutamic acid dipeptide repeats protein (RERE).	[37]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of Arginine-glutamic acid dipeptide repeats protein (RERE).	[38]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide increases the expression of Arginine-glutamic acid dipeptide repeats protein (RERE).	[41]
Methotrexate	DM2TEOL	Approved	Methotrexate increases the expression of Arginine-glutamic acid dipeptide repeats protein (RERE).	[42]
Urethane	DM7NSI0	Phase 4	Urethane increases the expression of Arginine-glutamic acid dipeptide repeats protein (RERE).	[44]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of Arginine-glutamic acid dipeptide repeats protein (RERE).	[46]
UNC0379	DMD1E4J	Preclinical	UNC0379 decreases the expression of Arginine-glutamic acid dipeptide repeats protein (RERE).	[47]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A decreases the expression of Arginine-glutamic acid dipeptide repeats protein (RERE).	[49]

References

• [1] Identification of critical regions and candidate genes for cardiovascular malformations and cardiomyopathy associated with deletions of chromosome 1p36.PLoS One. 2014 Jan 15;9(1):e85600. doi: 10.1371/journal.pone.0085600. eCollection 2014.
• [2] Technical standards for the interpretation and reporting of constitutional copy-number variants: a joint consensus recommendation of the American College of Medical Genetics and Genomics (ACMG) and the Clinical Genome Resource (ClinGen). Genet Med. 2020 Feb;22(2):245-257. doi: 10.1038/s41436-019-0686-8. Epub 2019 Nov 6.
• [3] Evaluation of Glucose and Lipid Lowering Activity of Arganimide A in Normal and Streptozotocin-Induced Diabetic Rats.Endocr Metab Immune Disord Drug Targets. 2019;19(4):503-510. doi: 10.2174/1871530318666181113124727.
• [4] Transformation of Ba/F3 cells and Rat-1 cells by ETV6/ARG.Oncogene. 2002 Jun 27;21(28):4374-83. doi: 10.1038/sj.onc.1205544.
• [5] Identification of risk loci with shared effects on five major psychiatric disorders: a genome-wide analysis.Lancet. 2013 Apr 20;381(9875):1371-1379. doi: 10.1016/S0140-6736(12)62129-1. Epub 2013 Feb 28.
• [6] De Novo Mutations of RERE Cause a Genetic Syndrome with Features that Overlap Those Associated with Proximal 1p36 Deletions. Am J Hum Genet. 2016 May 5;98(5):963-970. doi: 10.1016/j.ajhg.2016.03.002. Epub 2016 Apr 14.
• [7] Evaluation of ARG protein expression in mature B cell lymphomas compared to non-neoplastic reactive lymph node.Cell Immunol. 2009;259(2):111-6. doi: 10.1016/j.cellimm.2009.06.004. Epub 2009 Jun 6.
• [8] Polymorphic variation of the ARP gene on 3p21 in Japanese esophageal cancer patients.Oncol Rep. 2000 May-Jun;7(3):591-3. doi: 10.3892/or.7.3.591.
• [9] Leveraging Polygenic Functional Enrichment to Improve GWAS Power.Am J Hum Genet. 2019 Jan 3;104(1):65-75. doi: 10.1016/j.ajhg.2018.11.008. Epub 2018 Dec 27.
• [10] Community Screening, Identification, and Referral to Primary Care, for Hepatitis C, B, and HIV Among Homeless Persons in Los Angeles.J Community Health. 2019 Dec;44(6):1044-1054. doi: 10.1007/s10900-019-00679-w.
• [11] Novel differential gene expression in human cirrhosis detected by suppression subtractive hybridization.Hepatology. 2003 Sep;38(3):577-88. doi: 10.1053/jhep.2003.50376.
• [12] Gene expression signatures in polyarticular juvenile idiopathic arthritis demonstrate disease heterogeneity and offer a molecular classification of disease subsets.Arthritis Rheum. 2009 Jul;60(7):2113-23. doi: 10.1002/art.24534.
• [13] Genome-wide meta-analysis of depression identifies 102 independent variants and highlights the importance of the prefrontal brain regions.Nat Neurosci. 2019 Mar;22(3):343-352. doi: 10.1038/s41593-018-0326-7. Epub 2019 Feb 4.
• [14] Constitutively active ABL family kinases, TEL/ABL and TEL/ARG, harbor distinct leukemogenic activities in vivo.Leukemia. 2017 Dec;31(12):2742-2751. doi: 10.1038/leu.2017.114. Epub 2017 Apr 7.
• [15] Disclosure of erlotinib as a multikinase inhibitor in pancreatic ductal adenocarcinoma.Neoplasia. 2011 Nov;13(11):1026-34. doi: 10.1593/neo.111016.
• [16] Molecular epidemiology of childhood mitochondrial encephalomyopathies in a Finnish population: sequence analysis of entire mtDNA of 17 children reveals heteroplasmic mutations in tRNAArg, tRNAGlu, and tRNALeu(UUR) genes.Pediatrics. 2004 Aug;114(2):443-50. doi: 10.1542/peds.114.2.443.
• [17] Genomewide Study of Epigenetic Biomarkers of Opioid Dependence in European- American Women.Sci Rep. 2019 Mar 15;9(1):4660. doi: 10.1038/s41598-019-41110-7.
• [18] Functional and morphological abnormalities of mitochondria in human cells containing mitochondrial DNA with pathogenic point mutations in tRNA genes.J Biol Chem. 1994 Jul 22;269(29):19060-6.
• [19] A novel mitochondrial tRNA Arg mutation resulting in an anticodon swap in a patient with mitochondrial encephalomyopathy.Eur J Hum Genet. 2013 May;21(5):571-3. doi: 10.1038/ejhg.2012.153. Epub 2012 Jul 11.
• [20] Meta-analysis of genome-wide association studies for neuroticism in 449,484 individuals identifies novel genetic loci and pathways.Nat Genet. 2018 Jul;50(7):920-927. doi: 10.1038/s41588-018-0151-7. Epub 2018 Jun 25.
• [21] Classification of Genes: Standardized Clinical Validity Assessment of Gene-Disease Associations Aids Diagnostic Exome Analysis and Reclassifications. Hum Mutat. 2017 May;38(5):600-608. doi: 10.1002/humu.23183. Epub 2017 Feb 13.
• [22] Lack of association between UGT1A7, UGT1A9, ARP, SPINK1 and CFTR gene polymorphisms and pancreatic cancer in Italian patients.World J Gastroenterol. 2006 Oct 21;12(39):6343-8. doi: 10.3748/wjg.v12.i39.6343.
• [23] An Evaluation of Factors Associated With Pathogenic PRSS1, SPINK1, CTFR, and/or CTRC Genetic Variants in Patients With Idiopathic Pancreatitis.Am J Gastroenterol. 2017 Aug;112(8):1320-1329. doi: 10.1038/ajg.2017.106. Epub 2017 Apr 25.
• [24] Genome-Wide Association Study Detected Novel Susceptibility Genes for Schizophrenia and Shared Trans-Populations/Diseases Genetic Effect.Schizophr Bull. 2019 Jun 18;45(4):824-834. doi: 10.1093/schbul/sby140.
• [25] Genotype-phenotype correlations in individuals with pathogenic RERE variants.Hum Mutat. 2018 May;39(5):666-675. doi: 10.1002/humu.23400. Epub 2018 Jan 25.
• [26] RERE deficiency leads to decreased expression of GATA4 and the development of ventricular septal defects.Dis Model Mech. 2018 Aug 28;11(9):dmm031534. doi: 10.1242/dmm.031534.
• [27] Genome-wide association studies of autoimmune vitiligo identify 23 new risk loci and highlight key pathways and regulatory variants.Nat Genet. 2016 Nov;48(11):1418-1424. doi: 10.1038/ng.3680. Epub 2016 Oct 10.
• [28] Genome-wide association and HLA fine-mapping studies identify risk loci and genetic pathways underlying allergic rhinitis.Nat Genet. 2018 Aug;50(8):1072-1080. doi: 10.1038/s41588-018-0157-1. Epub 2018 Jul 16.
• [29] The E-selectin SER128ARG gene polymorphism and restenosis after successful coronary angioplasty.Int J Cardiol. 2002 Jun;83(3):249-57. doi: 10.1016/s0167-5273(02)00073-6.
• [30] Wheat Protein Hydrolysate Fortified With l-Arginine Enhances Satiation Induced by the Capsaicinoid Nonivamide in Moderately Overweight Male Subjects.Mol Nutr Food Res. 2019 Dec;63(23):e1900133. doi: 10.1002/mnfr.201900133. Epub 2019 Oct 2.
• [31] Genetic Architectures of Childhood- and Adult-Onset Asthma Are Partly Distinct.Am J Hum Genet. 2019 Apr 4;104(4):665-684. doi: 10.1016/j.ajhg.2019.02.022. Epub 2019 Mar 28.
• [32] Genetic overlap of chronic obstructive pulmonary disease and cardiovascular disease-related traits: a large-scale genome-wide cross-trait analysis.Respir Res. 2019 Apr 2;20(1):64. doi: 10.1186/s12931-019-1036-8.
• [33] ETV6/ARG oncoprotein confers autonomous cell growth by enhancing c-Myc expression via signal transducer and activator of transcription 5 activation in the acute promyelocytic leukemia cell line HT93A.Leuk Lymphoma. 2015;56(8):2416-23. doi: 10.3109/10428194.2014.982643. Epub 2014 Dec 4.
• [34] Multicentre surveillance of prevalence of the 23S rRNA A2058G and A2059G point mutations and molecular subtypes of Treponema pallidum in Taiwan, 2009-2013.Clin Microbiol Infect. 2014 Aug;20(8):802-7. doi: 10.1111/1469-0691.12529. Epub 2014 Feb 13.
• [35] Screening Feature Genes of Venous Thromboembolism with DNA Microarray.Chem Biol Drug Des. 2015 Oct;86(4):821-8. doi: 10.1111/cbdd.12557. Epub 2015 Apr 1.
• [36] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [37] Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
• [38] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [39] Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
• [40] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [41] Arsenic suppresses gene expression in promyelocytic leukemia cells partly through Sp1 oxidation. Blood. 2005 Jul 1;106(1):304-10.
• [42] Global molecular effects of tocilizumab therapy in rheumatoid arthritis synovium. Arthritis Rheumatol. 2014 Jan;66(1):15-23.
• [43] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
• [44] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [45] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [46] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [47] Epigenetic siRNA and chemical screens identify SETD8 inhibition as a therapeutic strategy for p53 activation in high-risk neuroblastoma. Cancer Cell. 2017 Jan 9;31(1):50-63.
• [48] Expression and DNA methylation changes in human breast epithelial cells after bisphenol A exposure. Int J Oncol. 2012 Jul;41(1):369-77.
• [49] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.