Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT4H6FFA)

DOT Name	Sarcoma antigen 1 (SAGE1)
Synonyms	Cancer/testis antigen 14; CT14
Gene Name	SAGE1
Related Disease	Advanced cancer ( ) Alcohol dependence ( ) Barrett esophagus ( ) Breast cancer ( ) Carcinoma ( ) Carcinoma of esophagus ( ) Clear cell renal carcinoma ( ) Depression ( ) Esophageal cancer ( ) Gastric cancer ( ) Hepatitis B virus infection ( ) Hepatocellular carcinoma ( ) Lung cancer ( ) Lung carcinoma ( ) Major depressive disorder ( ) Medulloblastoma ( ) Mental disorder ( ) Metastatic prostate carcinoma ( ) Myelodysplastic syndrome ( ) Neoplasm ( ) Neoplasm of esophagus ( ) Nicotine dependence ( ) Non-small-cell lung cancer ( ) Postpartum depression ( ) Renal cell carcinoma ( ) Seminoma ( ) Skin disease ( ) Squamous cell carcinoma ( ) Status epilepticus seizure ( ) Stomach cancer ( ) Thyroid cancer ( ) Thyroid gland carcinoma ( ) Thyroid tumor ( ) Breast carcinoma ( ) Lung neoplasm ( ) Melanoma ( ) Obesity ( ) Retinopathy ( ) Amyotrophic lateral sclerosis ( ) Ankylosing spondylitis ( ) Asthma ( ) Chronic obstructive pulmonary disease ( ) Glioma ( ) High blood pressure ( ) Non-insulin dependent diabetes ( ) Parkinson disease ( ) Rectal carcinoma ( ) Venous thromboembolism ( )
UniProt ID	SAGE1_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Pfam ID	PF15300
Sequence	MQASPLQTSQPTPPEELHAAAYVFTNDGQQMRSDEVNLVATGHQSKKKHSRKSKRHSSSK RRKSMSSWLDKQEDAAVTHSICEERINNGQPVADNVLSTAPPWPDATIAHNIREERMENG QSRTDKVLSTAPPQLVHMAAAGIPSMSTRDLHSTVTHNIREERMENGQPQPDNVLSTGPT GLINMAATPIPAMSARDLYATVTHNVCEQKMENVQPAPDNVLLTLRPRRINMTDTGISPM STRDPYATITYNVPEEKMEKGQPQPDNILSTASTGLINVAGAGTPAISTNGLYSTVPHNV CEEKMENDQPQPNNVLSTVQPVIIYLTATGIPGMNTRDQYATITHNVCEERVVNNQPLPS NALSTVLPGLAYLATADMPAMSTRDQHATIIHNLREEKKDNSQPTPDNVLSAVTPELINL AGAGIPPMSTRDQYATVNHHVHEARMENGQRKQDNVLSNVLSGLINMAGASIPAMSSRDL YATITHSVREEKMESGKPQTDKVISNDAPQLGHMAAGGIPSMSTKDLYATVTQNVHEERM ENNQPQPSYDLSTVLPGLTYLTVAGIPAMSTRDQYATVTHNVHEEKIKNGQAASDNVFST VPPAFINMAATGVSSMSTRDQYAAVTHNIREEKINNSQPAPGNILSTAPPWLRHMAAAGI SSTITRDLYVTATHSVHEEKMTNGQQAPDNSLSTVPPGCINLSGAGISCRSTRDLYATVI HDIQEEEMENDQTPPDGFLSNSDSPELINMTGHCMPPNALDSFSHDFTSLSKDELLYKPD SNEFAVGTKNYSVSAGDPPVTVMSLVETVPNTPQISPAMAKKINDDIKYQLMKEVRRFGQ NYERIFILLEEVQGSMKVKRQFVEFTIKEAARFKKVVLIQQLEKALKEIDSHCHLRKVKH MRKR
Tissue Specificity	Expressed mainly in bladder, lung, head and neck carcinomas. Not expressed in normal tissues except for testis.

Molecular Interaction Atlas (MIA) of This DOT

48 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance
Advanced cancer	DISAT1Z9	Strong	Biomarker	[1]
Alcohol dependence	DIS4ZSCO	Strong	Biomarker	[2]
Barrett esophagus	DIS416Y7	Strong	Altered Expression	[3]
Breast cancer	DIS7DPX1	Strong	Biomarker	[4]
Carcinoma	DISH9F1N	Strong	Altered Expression	[5]
Carcinoma of esophagus	DISS6G4D	Strong	Biomarker	[6]
Clear cell renal carcinoma	DISBXRFJ	Strong	Altered Expression	[7]
Depression	DIS3XJ69	Strong	Genetic Variation	[8]
Esophageal cancer	DISGB2VN	Strong	Biomarker	[6]
Gastric cancer	DISXGOUK	Strong	Altered Expression	[9]
Hepatitis B virus infection	DISLQ2XY	Strong	Biomarker	[10]
Hepatocellular carcinoma	DIS0J828	Strong	Biomarker	[11]
Lung cancer	DISCM4YA	Strong	Altered Expression	[5]
Lung carcinoma	DISTR26C	Strong	Altered Expression	[5]
Major depressive disorder	DIS4CL3X	Strong	Biomarker	[12]
Medulloblastoma	DISZD2ZL	Strong	Biomarker	[13]
Mental disorder	DIS3J5R8	Strong	Genetic Variation	[14]
Metastatic prostate carcinoma	DISVBEZ9	Strong	Biomarker	[15]
Myelodysplastic syndrome	DISYHNUI	Strong	Altered Expression	[7]
Neoplasm	DISZKGEW	Strong	Biomarker	[16]
Neoplasm of esophagus	DISOLKAQ	Strong	Biomarker	[6]
Nicotine dependence	DISZD9W7	Strong	Genetic Variation	[17]
Non-small-cell lung cancer	DIS5Y6R9	Strong	Biomarker	[18]
Postpartum depression	DIS08UKE	Strong	Biomarker	[12]
Renal cell carcinoma	DISQZ2X8	Strong	Altered Expression	[7]
Seminoma	DIS3J8LJ	Strong	Altered Expression	[19]
Skin disease	DISDW8R6	Strong	Altered Expression	[20]
Squamous cell carcinoma	DISQVIFL	Strong	Biomarker	[18]
Status epilepticus seizure	DISY3BIC	Strong	Biomarker	[21]
Stomach cancer	DISKIJSX	Strong	Biomarker	[22]
Thyroid cancer	DIS3VLDH	Strong	Biomarker	[23]
Thyroid gland carcinoma	DISMNGZ0	Strong	Biomarker	[23]
Thyroid tumor	DISLVKMD	Strong	Biomarker	[23]
Breast carcinoma	DIS2UE88	moderate	Biomarker	[4]
Lung neoplasm	DISVARNB	moderate	Biomarker	[24]
Melanoma	DIS1RRCY	moderate	Biomarker	[25]
Obesity	DIS47Y1K	moderate	Biomarker	[26]
Retinopathy	DISB4B0F	moderate	Genetic Variation	[27]
Amyotrophic lateral sclerosis	DISF7HVM	Limited	Altered Expression	[28]
Ankylosing spondylitis	DISRC6IR	Limited	Genetic Variation	[29]
Asthma	DISW9QNS	Limited	Biomarker	[30]
Chronic obstructive pulmonary disease	DISQCIRF	Limited	Biomarker	[31]
Glioma	DIS5RPEH	Limited	Altered Expression	[32]
High blood pressure	DISY2OHH	Limited	Biomarker	[33]
Non-insulin dependent diabetes	DISK1O5Z	Limited	Biomarker	[34]
Parkinson disease	DISQVHKL	Limited	Genetic Variation	[35]
Rectal carcinoma	DIS8FRR7	Limited	Biomarker	[36]
Venous thromboembolism	DISUR7CR	Limited	Biomarker	[37]
------------------------------------------------------------------------------------


⏷ Show the Full List of 48 Disease(s)

Molecular Interaction Atlas (MIA)

MIA Detail

Jump to Detail Molecular Interaction Atlas of This DOT

2 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Sarcoma antigen 1 (SAGE1).	[38]
Acetaminophen	DMUIE76	Approved	Acetaminophen affects the expression of Sarcoma antigen 1 (SAGE1).	[39]
------------------------------------------------------------------------------------

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Sarcoma antigen 1 (SAGE1).	[40]
------------------------------------------------------------------------------------

References

1	Expression and mutations of BRCA in breast cancer and ovarian cancer: Evidence from bioinformatics analyses.Int J Mol Med. 2018 Dec;42(6):3542-3550. doi: 10.3892/ijmm.2018.3870. Epub 2018 Sep 11.
2	CYP2A6 is associated with obesity: studies in human samples and a high fat diet mouse model.Int J Obes (Lond). 2019 Mar;43(3):475-486. doi: 10.1038/s41366-018-0037-x. Epub 2018 Feb 20.
3	A comparative analysis by SAGE of gene expression profiles of Barrett's esophagus, normal squamous esophagus, and gastric cardia.Gastroenterology. 2005 Oct;129(4):1274-81. doi: 10.1053/j.gastro.2005.07.026.
4	Differential expression of neurogenes among breast cancer subtypes identifies high risk patients.Oncotarget. 2016 Feb 2;7(5):5313-26. doi: 10.18632/oncotarget.6543.
5	SAGE mRNA expression in advanced-stage lung cancers.Eur J Surg Oncol. 2003 Dec;29(10):900-3. doi: 10.1016/j.ejso.2003.06.001.
6	Genetic epidemiological analysis of esophageal cancer in high-incidence areas of China.Asian Pac J Cancer Prev. 2014;15(22):9859-63. doi: 10.7314/apjcp.2014.15.22.9859.
7	Despite differential gene expression profiles pediatric MDS derived mesenchymal stromal cells display functionality in vitro.Stem Cell Res. 2015 Mar;14(2):198-210. doi: 10.1016/j.scr.2015.01.006. Epub 2015 Jan 28.
8	Old age and depression in Ghana: assessing and addressing diagnosis and treatment gaps.Glob Health Action. 2019;12(1):1678282. doi: 10.1080/16549716.2019.1678282.
9	Identification of new splice variants and differential expression of the human kallikrein 10 gene, a candidate cancer biomarker.Tumour Biol. 2005 Sep-Oct;26(5):227-35. doi: 10.1159/000087377. Epub 2005 Aug 9.
10	Hepatitis B vaccine birth dose in India: time to reconsider.Hum Vaccin Immunother. 2020;16(1):158-160. doi: 10.1080/21645515.2019.1640557. Epub 2019 Sep 13.
11	Comprehensive gene expression analysis of 5'-end of mRNA identified novel intronic transcripts associated with hepatocellular carcinoma.Genomics. 2010 Apr;95(4):217-23. doi: 10.1016/j.ygeno.2010.01.004. Epub 2010 Jan 21.
12	SAGE-217, A Novel GABA(A) Receptor Positive Allosteric Modulator: Clinical Pharmacology and Tolerability in Randomized Phase I Dose-Finding Studies.Clin Pharmacokinet. 2020 Jan;59(1):111-120. doi: 10.1007/s40262-019-00801-0.
13	CIC, a gene involved in cerebellar development and ErbB signaling, is significantly expressed in medulloblastomas.J Neurooncol. 2005 Jun;73(2):101-8. doi: 10.1007/s11060-004-4598-2.
14	TACR1 genotypes predict fMRI response to alcohol cues and level of alcohol dependence.Alcohol Clin Exp Res. 2013 Jan;37 Suppl 1(Suppl 1):E125-30. doi: 10.1111/j.1530-0277.2012.01923.x. Epub 2012 Oct 18.
15	ASAP1, a gene at 8q24, is associated with prostate cancer metastasis.Cancer Res. 2008 Jun 1;68(11):4352-9. doi: 10.1158/0008-5472.CAN-07-5237.
16	OCT2, SSX and SAGE1 reveal the phenotypic heterogeneity of spermatocytic seminoma reflecting distinct subpopulations of spermatogonia.J Pathol. 2011 Aug;224(4):473-83. doi: 10.1002/path.2919. Epub 2011 Jun 27.
17	Combined genetic influence of the nicotinic receptor gene cluster CHRNA5/A3/B4 on nicotine dependence.BMC Genomics. 2018 Nov 20;19(1):826. doi: 10.1186/s12864-018-5219-3.
18	Transcriptome profiles of carcinoma-in-situ and invasive non-small cell lung cancer as revealed by SAGE.PLoS One. 2010 Feb 11;5(2):e9162. doi: 10.1371/journal.pone.0009162.
19	Chromosome X-encoded cancer/testis antigens show distinctive expression patterns in developing gonads and in testicular seminoma.Hum Reprod. 2011 Dec;26(12):3232-43. doi: 10.1093/humrep/der330. Epub 2011 Oct 20.
20	Gene expression profiling of lichen planus reflects CXCL9+-mediated inflammation and distinguishes this disease from atopic dermatitis and psoriasis.J Invest Dermatol. 2008 Jan;128(1):67-78. doi: 10.1038/sj.jid.5700945. Epub 2007 Aug 16.
21	Brexanolone as adjunctive therapy in super-refractory status epilepticus.Ann Neurol. 2017 Sep;82(3):342-352. doi: 10.1002/ana.25008. Epub 2017 Sep 11.
22	Analysis of gene expression profiles of gastric normal and cancer tissues by SAGE.Genomics. 2003 Jul;82(1):78-85. doi: 10.1016/s0888-7543(03)00098-3.
23	Modern approaches to age-old questions about thyroid tumors.Thyroid. 2005 Jun;15(6):575-82. doi: 10.1089/thy.2005.15.575.
24	Identification of MGB1 as a marker in the differential diagnosis of lung tumors in patients with a history of breast cancer by analysis of publicly available SAGE data.J Mol Diagn. 2004 May;6(2):90-5. doi: 10.1016/S1525-1578(10)60495-3.
25	SAGE and antibody array analysis of melanoma-infiltrated lymph nodes: identification of Ubc9 as an important molecule in advanced-stage melanomas.Oncogene. 2007 Jun 21;26(29):4216-25. doi: 10.1038/sj.onc.1210216. Epub 2007 Feb 12.
26	Early Life Displacement Due to Armed Conflict and Violence, Early Nutrition, and Older Adult Hypertension, Diabetes, and Obesity in the Middle-Income Country of Colombia.J Aging Health. 2019 Sep;31(8):1479-1502. doi: 10.1177/0898264318778111. Epub 2018 Jun 19.
27	Heritability of the severity of diabetic retinopathy: the FIND-Eye study.Invest Ophthalmol Vis Sci. 2008 Sep;49(9):3839-45. doi: 10.1167/iovs.07-1633.
28	SAGE analysis of genes differentially expressed in presymptomatic TgSOD1G93A transgenic mice identified cellular processes involved in early stage of ALS pathology.J Mol Neurosci. 2010 May;41(1):172-82. doi: 10.1007/s12031-009-9317-1. Epub 2009 Dec 2.
29	Atherosclerosis in male patients with ankylosing spondylitis: the relation with methylenetetrahydrofolate reductase (C677T) gene polymorphism and plasma homocysteine levels.Rheumatol Int. 2013 Jun;33(6):1519-24. doi: 10.1007/s00296-012-2552-8. Epub 2012 Dec 18.
30	Genome-Wide Interaction Analysis of Air Pollution Exposure and Childhood Asthma with Functional Follow-up.Am J Respir Crit Care Med. 2017 May 15;195(10):1373-1383. doi: 10.1164/rccm.201605-1026OC.
31	The economic burden of chronic obstructive pulmonary disease (COPD) in Europe: results from a systematic review of the literature.Eur J Health Econ. 2020 Mar;21(2):181-194. doi: 10.1007/s10198-019-01119-1. Epub 2019 Sep 28.
32	Vascular gene expression in nonneoplastic and malignant brain.Am J Pathol. 2004 Aug;165(2):601-8. doi: 10.1016/s0002-9440(10)63324-x.
33	Predictors of hypertension awareness, treatment and control in South Africa: results from the WHO-SAGE population survey (Wave 2).J Hum Hypertens. 2019 Feb;33(2):157-166. doi: 10.1038/s41371-018-0125-3. Epub 2018 Oct 31.
34	Segregation analysis of non-insulin-dependent diabetes mellitus in Pima Indians: evidence for a major-gene effect.Am J Hum Genet. 1995 Jul;57(1):160-70.
35	Genomic convergence to identify candidate genes for Parkinson disease: SAGE analysis of the substantia nigra.Mov Disord. 2005 Oct;20(10):1299-309. doi: 10.1002/mds.20573.
36	A combined strategy of SAGE and quantitative PCR Provides a 13-gene signature that predicts preoperative chemoradiotherapy response and outcome in rectal cancer.Clin Cancer Res. 2011 Jun 15;17(12):4145-54. doi: 10.1158/1078-0432.CCR-10-2257. Epub 2011 Apr 5.
37	Venous thromboembolism chemoprophylaxis regimens in trauma and surgery patients with obesity: A systematic review.J Trauma Acute Care Surg. 2020 Apr;88(4):522-535. doi: 10.1097/TA.0000000000002538.
38	Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
39	Blood transcript immune signatures distinguish a subset of people with elevated serum ALT from others given acetaminophen. Clin Pharmacol Ther. 2016 Apr;99(4):432-41.
40	Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.